SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005633 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000005633
Domain Number 1 Region: 28-110
Classification Level Classification E-value
Superfamily RING/U-box 4.62e-34
Family RING finger domain, C3HC4 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005633   Gene: ENSNLEG00000004646   Transcript: ENSNLET00000005925
Sequence length 113
Comment pep:known_by_projection supercontig:Nleu1.0:GL397300.1:18015200:18022298:1 gene:ENSNLEG00000004646 transcript:ENSNLET00000005925 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADVEDGEETCALASHSGSSGSKSGGDKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDA
CLRCQAENKQEDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRIGK
Download sequence
Identical sequences A0A096N037 A0A0D9RFM8 A0A2I3GDA7 A0A2I3S2X5 A0A2K5JXS7 A0A2K5NNU8 A0A2K5TYF1 A0A2K6B5J9 A0A2K6N4K0 G3QHH4 H2PBM2 I0FWN9 Q9UBF6
GO.39105 HR3085 gi|7657522|ref|NP_055060.1| ENSP00000273480 ENSPTRP00000026642 ENSPTRP00000026643 ENSNLEP00000005633 ENSPTRP00000026642 ENSPTRP00000026643 ENSGGOP00000001803 ENSPPYP00000015846 ENSMMUP00000008743 ENSP00000273480 9544.ENSMMUP00000008743 9598.ENSPTRP00000026643 9600.ENSPPYP00000015846 9606.ENSP00000273480 ENSPPYP00000015846 NP_001239486.1.37143 NP_001253405.1.72884 NP_055060.1.87134 NP_055060.1.92137 XP_002814164.1.23681 XP_003265375.1.23891 XP_003826573.1.60992 XP_004037819.1.27298 XP_005546022.1.63531 XP_008007087.1.81039 XP_010376571.1.97406 XP_011719952.1.29376 XP_011813482.1.43180 XP_011858040.1.47321 XP_011916637.1.92194 XP_017718135.1.44346 ENSGGOP00000001803 ENSNLEP00000005633 ENSP00000273480 ENSPANP00000005601 ENSMMUP00000008743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]