SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005651 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000005651
Domain Number 1 Region: 30-77,108-165
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000745
Family I set domains 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005651   Gene: ENSNLEG00000004668   Transcript: ENSNLET00000005944
Sequence length 496
Comment pep:known_by_projection supercontig:Nleu1.0:GL397358.1:6704479:6710155:1 gene:ENSNLEG00000004668 transcript:ENSNLET00000005944 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWEAQLLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLRLLRRAG
VTWQHQPDSGPPAPAPGHPLTPGPRPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRV
QLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASSMLGLTPAIS
VCRDSSSMPLSHWQSSQVSLRWERSSSLPRGERTGREEGLAGQRLQTHPVMPGHWAQVPE
PAHLGPHFSHPHNKETKLKPLIKFNKKLNRKKKMNVAMTPDPSVTSPGQNPSECRVIETW
GSTCGITWGQNPKRSLLLLFSVTPKSFGSPGSLGKLLCEVTPASGQERFVWSPLDTPSQR
SFSGRWLEAQEAQLVSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALQAGHLL
LFLILGILSLLLLVTGAFGFHLWRRQWRPRRFSALEQGIHPPQAQSKIEELEQEPEPEPE
PEPEPELGPEPKPEQL
Download sequence
Identical sequences ENSNLEP00000005651 ENSNLEP00000005651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]