SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005713 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000005713
Domain Number 1 Region: 33-147
Classification Level Classification E-value
Superfamily Immunoglobulin 1.92e-21
Family V set domains (antibody variable domain-like) 0.00000175
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005713   Gene: ENSNLEG00000004664   Transcript: ENSNLET00000006011
Sequence length 295
Comment pep:known_by_projection supercontig:Nleu1.0:GL397342.1:6620528:6636976:1 gene:ENSNLEG00000004664 transcript:ENSNLET00000006011 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASLSRPSLPSCLCSFPLLLLLQVSSSYAGQFRVIGPRHPIRALVGDEVELPCRISPGKN
ATGMEVGWYRPPFSRVVHLYRNGRDQDGEQAPEYRGRTELLKDAIGEGKVTLRIQNVRFS
DEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPGVLVLLAVLPVLLLQITVGLVFLCLQY
RLRGKLRAEIENLHRTFDPHFLRVPCWKITLFVIVPVLGPLVALIICYNWLHRRLAGQFL
EELSKFSSLSYKQRIKSQERETEATRGRGGLLRDHIPRGKEELESLGGGKTPPGR
Download sequence
Identical sequences A0A2I3GSL5
ENSNLEP00000005713 XP_012358697.1.23891 ENSNLEP00000005713

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]