SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005726 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000005726
Domain Number 1 Region: 227-297
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000139
Family RING finger domain, C3HC4 0.036
Further Details:      
 
Domain Number 2 Region: 32-56
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000144
Family CCCH zinc finger 0.0043
Further Details:      
 
Domain Number 3 Region: 3-27
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000327
Family CCCH zinc finger 0.0052
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000005726
Domain Number - Region: 165-189
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000131
Family CCCH zinc finger 0.0052
Further Details:      
 
Domain Number - Region: 323-351
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000471
Family CCCH zinc finger 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005726   Gene: ENSNLEG00000004711   Transcript: ENSNLET00000006024
Sequence length 415
Comment pep:known_by_projection supercontig:Nleu1.0:GL397298.1:20138492:20173083:1 gene:ENSNLEG00000004711 transcript:ENSNLET00000006024 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTKQVTCRYFMHGVCREGSQCLFSHDLANSKPSTICKYYQKGYCAYGTRCRYDHTRPSA
AAGGAVGTMAHSVPSPAFHSPHPPSEVTASIVKTNSHEPGKREKRTLVLRDRNLSGMAEG
KTQPSMASNPGSCSDPQPSPEMKPHSYLDAIRSGLDVEASSSYSSEQQLCPYAAAGECRF
GDTCVYLHGEVCEICRLQVLHPLDPEQRKAHEKICMLTFEHEMEKAFAFQASQDKVCSIC
MEVILEKASASERRFGILSNCNHTYCLSCIRQWRCAKQFENPIIKSCPECRVISEFVIPS
VYWVEDQNKKNELIEAFKQGMGKKACKYFEQGKGTCPFGSKCLYRHAYPDGRLAEPEKPR
KQLSSQGTVRFFNSVRLWDFIENRESRHVPNNEDVDVTELGDLFMHLSGVESSEP
Download sequence
Identical sequences G1QXQ5
ENSNLEP00000005726 XP_003265044.1.23891 ENSNLEP00000005726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]