SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005758 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000005758
Domain Number 1 Region: 155-344
Classification Level Classification E-value
Superfamily E set domains 1.63e-64
Family Cytoplasmic domain of inward rectifier potassium channel 0.0000191
Further Details:      
 
Domain Number 2 Region: 49-169
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.18e-18
Family Voltage-gated potassium channels 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005758   Gene: ENSNLEG00000004751   Transcript: ENSNLET00000006057
Sequence length 375
Comment pep:known_by_projection supercontig:Nleu1.0:GL397293.1:23686332:23737215:1 gene:ENSNLEG00000004751 transcript:ENSNLET00000006057 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAIHIGMSSTPLVKHTAGTGLKANRPRVMSKSGHSNVRIDKVDGIYLLYLQDLWTTVID
MKWRYKLTLFAATFVMTWFLFGVIYYAIAFIHGDLEPGEPISNHTPCIMKVDSLTGAFLF
SLESQTTIGYGVRSITEECPHAIFLLVAQLVITTLIEIFITGTFLAKIARPKKRAETIKF
SHCAVITKQNGKLCLVIQVANMRKSLLIQCQLSGKLLQTHVTKEGERILLNQATVKFHVD
SSSESPFLILPMTFYHVLDETSPLRDLTPQNLKEKEFELVVLLNATVESTSAVCQSRTSY
IPEEIYWGFEFVPVVSLSKNGKYVADFSQFEQIRKSPDCTFYCADSEKQQLEEKYRQEDQ
RERELRTLLLQQSNV
Download sequence
Identical sequences A0A2I3HPN4
ENSNLEP00000005758 XP_003263971.1.23891 XP_003263972.1.23891 XP_003263973.1.23891 XP_003263975.1.23891 XP_003263976.1.23891 XP_004092364.1.23891 XP_004092365.1.23891 XP_004092366.1.23891 XP_012357372.1.23891 XP_012357373.1.23891 XP_012357374.1.23891 XP_012357375.1.23891 XP_012357376.1.23891 XP_012357377.1.23891 XP_012357378.1.23891 XP_012357379.1.23891 ENSNLEP00000005758

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]