SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005774 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000005774
Domain Number 1 Region: 1547-1655
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.76e-35
Family Spermadhesin, CUB domain 0.00027
Further Details:      
 
Domain Number 2 Region: 848-963
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.02e-33
Family Spermadhesin, CUB domain 0.0005
Further Details:      
 
Domain Number 3 Region: 201-303
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-32
Family Spermadhesin, CUB domain 0.00067
Further Details:      
 
Domain Number 4 Region: 685-789
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-32
Family Spermadhesin, CUB domain 0.00046
Further Details:      
 
Domain Number 5 Region: 1898-2007
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-32
Family Spermadhesin, CUB domain 0.00046
Further Details:      
 
Domain Number 6 Region: 2065-2185
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.05e-31
Family Spermadhesin, CUB domain 0.00073
Further Details:      
 
Domain Number 7 Region: 2236-2355
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.36e-31
Family Spermadhesin, CUB domain 0.00097
Further Details:      
 
Domain Number 8 Region: 25-131
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-29
Family Spermadhesin, CUB domain 0.00043
Further Details:      
 
Domain Number 9 Region: 1367-1483
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.53e-28
Family Spermadhesin, CUB domain 0.00073
Further Details:      
 
Domain Number 10 Region: 508-618
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-27
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 11 Region: 2424-2528
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.49e-26
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 12 Region: 1027-1136
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.15e-26
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 13 Region: 1200-1309
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.88e-25
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 14 Region: 1715-1830
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-24
Family Spermadhesin, CUB domain 0.0043
Further Details:      
 
Domain Number 15 Region: 3131-3202
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.64e-20
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 16 Region: 2776-2844
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.83e-19
Family Complement control module/SCR domain 0.00083
Further Details:      
 
Domain Number 17 Region: 3015-3083
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.61e-18
Family Complement control module/SCR domain 0.00091
Further Details:      
 
Domain Number 18 Region: 2833-2901
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.78e-18
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 19 Region: 2891-2964
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.05e-18
Family Complement control module/SCR domain 0.00084
Further Details:      
 
Domain Number 20 Region: 3072-3142
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 9.73e-18
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 21 Region: 3191-3260
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 8.5e-17
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 22 Region: 2717-2786
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.64e-16
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 23 Region: 3250-3306
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000111
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 24 Region: 2183-2252
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000112
Family Complement control module/SCR domain 0.00087
Further Details:      
 
Domain Number 25 Region: 445-516
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000153
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 26 Region: 2590-2657
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000208
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 27 Region: 2947-3008
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000459
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 28 Region: 3311-3379
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000542
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 29 Region: 2528-2601
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000181
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 30 Region: 2011-2073
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000391
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 31 Region: 1487-1551
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000432
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 32 Region: 1660-1725
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000987
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 33 Region: 623-682
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000138
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 34 Region: 969-1029
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000148
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 35 Region: 1837-1903
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000208
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 36 Region: 1142-1204
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000031
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 37 Region: 137-198
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000513
Family Complement control module/SCR domain 0.0008
Further Details:      
 
Domain Number 38 Region: 1313-1375
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000132
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 39 Region: 3370-3428
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000195
Family Complement control module/SCR domain 0.0026
Further Details:      
 
Domain Number 40 Region: 794-862
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000364
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 41 Region: 2662-2724
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000417
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 42 Region: 2354-2417
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000688
Family Complement control module/SCR domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005774   Gene: ENSNLEG00000004538   Transcript: ENSNLET00000006076
Sequence length 3667
Comment pep:known_by_projection supercontig:Nleu1.0:GL397267.1:26112684:27289219:-1 gene:ENSNLEG00000004538 transcript:ENSNLET00000006076 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWSWFLCQKPVQLDQRPQVGFIYTCGGTLKGLNGTIESPGFPYGYPNGANCTWVIIAEER
NRIQIVFQSFALEEEYDYLSLYDGHPHPTNFRTRLTGFHLPPPVTSTKSVFSLRLTSDFA
VSAHGFKVYYEELQSSSCGNPGVPPKGVLYGTRFDVGDKIRYSCVTGYILDGHPQLTCIA
NSVNTASWDFPVPICRAEDACGGTMRGSSGIISSPSFPNEYHNNADCTWTIVAEPGDTIS
LIFTDFQMEEKYDYLEIEGSEPPTIWLSGMNIPPPIISNKNWLRLHFVTDSNHRYRGFSA
PYQGSSTLTHTTSTGELEEHNRTTTGAIAVASTPADVTVSSVTAVTIHRLSEEQRVQVTS
LRNSGLDPNTSKDGLSPHQADTQSTRRRPRHAEQIERTKELAVVTHRVKKAIDFKSRGFK
LFPGKDNSNKFSILNEGGIKTASNLCPDPGEPENGKRIGSDFSLGSTVQFSCDEDYVLQG
AKSITCQRIAEVFAAWSDHRPVCKVKTCGSNLQGPSGTFTSPNFPFQYDSNAQCVWVITA
VNTNKVIQINFEEFDLEIGYDTLTIGDGGEVGDPRTVLQVLTGSFVPDLIVSMSSQMWLH
LQTDESVGSVGFKVNYKEIEKESCGDPGTPLYGIREGDGFSNRDVLRFECQFGFELIGEK
SIVCQENNQWSANIPICIFPCLSNFTAPMGTVLSPDYPEGYGNNLNCIWTIISDPGSRIH
LSFNDFDLESQFDFLAVKDGDSPDSPILGTFTGAEVPSHLTSNSHILRLEFQADHSMSGR
GFNITYNTFGHNECPDPGIPINARRFGDNFQLGSSISVICEEGFIKTQGTETITCILMDG
KVMWSGPIPKCGAPCGGHFSAPSGVILSPGWPGYYKDSLNCEWVIEAEPGHSIKITFERF
QTELNYDVLEVHDGPNLLSPLLGSYNGTQVPQFLFSSSNFIYLLFTTDNSRSNNGFKIHY
ESVTVNTYSCLDPGIPVHGRRYGHDFSIGSTVSFSCYPGYRLSHEEPLLCEKNHWWSHPL
PTCDALCGGDVRGPSGTILSPGYPEFYPNSLNCTWTVDVTHGKGVQFNFHTFHLEDHHDY
LLITENGSFTQPLARLTGSDLPPTINAGLYGNFRAQLRFISDFSISYEGFNITFSEYNLE
PCEDPGIPQYGSRIGFNFGVGDTLTFSCSSGYRLEGTSEIICLGGGRRVWSAPLPRCVAE
CGASATNNEGILLSPNYPLNYENNHECIYSIQVQAGKGINISARTFHLAQGDVLKIYDGK
DKTTHLLGAFTGASMRGLTLSSTSNQLWLEFNSDSEGTDEGFQLVYTSFELSHCEDPGIP
QFGYKISDQGHFAGSTIIYGCNPGYTLHGSSLLKCMTGERRAWDYPLPSCIAECGGRFKG
ESSGRILSPGYPFPYDNNLRCMWMIEVDPGNIVSLQFLAFDTEASHDILRVWDGPPENEM
LLKEISGSLIPEGIHSTLNIVTIQFDTDFYISKSGFAIQFSSSVATACRDPGVPMNGTRN
GDGREPGDTVVFQCDPGYELQGEERITCIQVENRYFWQPSPPVCIAPCGGNLTGSSGFIL
SPNFPHPYPHSRDCDWTITVNADYVISLAFISFSIEPNYDFLYIYDGPDSNSPLIGSFQD
SKLPERIESSSNTMHLAFRSDGSVSYTGFHLEYKAKLRESCFDPGNIMNGTRLGMDYKLG
STVTYYCDAGYVLQGYSTLTCIMGDDGRPGWNRALPSCHAPCGSRSTGSEGTVLSPNYPK
NYSVGHNCVYSIAVPKEFVVFGQFVFFQTSLHDVVEVYDGPTQQSSLLSSLSGSHSGESL
PLSSGNQITIRFTSVGPITAKGFHFVYQAVPRTSSTQCSSVPEPRFGRRIGNEFAVGSLV
LFECNPGYILHGSIAIRCETVPNSLAQWNDSLPTCIVPCGGILTKRKGTILSPGYPEPYD
NNLNCVWKITVPEGAGIQVQVVSFATEHNWDSLDFYDGGDNNAPRLGSYSGTTIPHLLNS
TSNNLYLNFQSDISVSAAGFHLEYTAIGLDSCPEPQTPSSGIKIGDRYMVGDVVSFQCDQ
GYSLQGHSHITCMPGPVRRWNYPIPICLAQCGGAMSDFSGVILSPGFPGNYPSSLDCTWT
IKLPIGFGVHLQFVNFSTETIHDYLEVRSGSSETSTVIGRLSGPQIPSSLFSTTHETSLY
FHSDYSQNKQGFHIVYQAYQLQSCPDPRPFRNGFVIGNDFTVGQTISFECFPGYTLIGSS
ALTCLHGVSRNWNHPLPRCEALCGGNITAMNGTIYSPGYPDEYPNFQDCFWLVRVPPGNG
IYINFTVLQTEPIYDFITVWDGPDQNSPQIGQFSGNTALESVYSTSNQILIKFHSDFTTS
GFFVLSYHAYQLRVCQPPPPVPNAEILTEDDEFEIGDIIRYQCLPGFTLVGNAILTCRLG
ERLQMDGAPPVCQVLCPANELRLDSTGVILSPGYPDSYPNLQMCAWSISVEKGYNITMFV
EFFQTEKEFDVLQVYDGPNIQSPVLISLSGDYSSAFNITSNGHEVFLQWSADHGNNKKGF
RIRYIAFYCSTPESPPHGYIISQTGGQLNSVVRWACDRGFRLVGKSSAVCRKSSYGYHAW
DAPVPACQAISCGIPKAPTNGGILTTDYLVGTRVTYFCNDGYRLSSKELTTAVCQSDGTW
SNHNKTPRCVVVTCPSINSFTLEHGRWRIVNGSHYEYKTKVVFSCDPGYHGLGPASIECL
PNGTWSWRNERPYCQIISCGELPTPPNGNKIGTQTSYGSTAIFTCDLGFMLVGSAVRECL
SSGLWSESETRCLAGHCGIPEPIVNGQVIGENYGYRDTVVYQCNPGFRLIGSSVRICQQD
HNWSGQLPSCVPVSCGHPGSPIYGRTSGNGFNFNDVVTFSCNIGYLMQGPTKAQCQANRQ
WSHPPPMCKVVNCSDPGIPANSKRESKIEHGNFTYGTVVFYDCNPGYFLFGSSVLICQPN
GQWDKPLPECIMIDCGHPGVPPNAVLSGEKYTFGSTVHYSCTGKRSLLGQSSRTCQLNGH
WSGSQPHCSGDATGTCGDPGTPGHGSRQESNFRTKSTVRYACDTGYILHGSEERTCLANG
SWTGRQPECKAVQCGNPGTTANGKVFRIDGTTFPSSVIYSCMEGYILSGPSVRQCTANGT
WSGAVPNCTIISCGDPGIPANGLRYGDDYVVGQNVSYMCQPGYMMELNGSRIRTCTINGT
WSGVMATCRAVTCPTPPQISNGRLEGTNFDWGFSISYICSPGYELSFPAVLTCVGNGTWS
GEVPQCLPKFCGDPGIPAQGKREGKSFIYQSEVSFSCNSPYILVGSSTRICQADGTWSGS
SPHCIEPTRTSCENPGVPRHGSQNNTFGFQVGSIVQFHCKKGHLLQGSTTRTCLPDLTWS
GIQPECIPHSCKQPETPAHANVVGMDLPSHGYTLIYTCQPGFFLAGGTEHRVCRSDNTWT
GKVPVCEAGSKILVKDPRPALGTPSPKLSVPDDVFAQNYIWKGSYNFKGRKQPMTLTVTS
FNASTGRVNATLSNRNMELLLSGVYKSQEARLMLHIYLIKVPAHASVKKMKEENWAMDGF
VSAEPDGATYVFQGFIQGKDYGQFGLQRLGLNMSEGSNSSNQPHGTNSSSVAIAILVPFF
ALIFAGFGFYLYKQRTAPKTQYTGCSVHENNNGQAAFENPMYDTNAKSVEGKAVRFDPNL
NTVCTMV
Download sequence
Identical sequences ENSNLEP00000005774

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]