SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005785 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000005785
Domain Number 1 Region: 15-110,161-411,515-574
Classification Level Classification E-value
Superfamily MFS general substrate transporter 3.4e-38
Family Glycerol-3-phosphate transporter 0.082
Further Details:      
 
Domain Number 2 Region: 433-486
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000582
Family Ovomucoid domain III-like 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005785   Gene: ENSNLEG00000004749   Transcript: ENSNLET00000006089
Sequence length 670
Comment pep:known_by_projection supercontig:Nleu1.0:GL397301.1:12591210:12653956:-1 gene:ENSNLEG00000004749 transcript:ENSNLET00000006089 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGETEKRIETHRIRCLSKLKMFLLAITCAFVSKTLSGSYMNSMLTQIERQFNIPTSLVGF
INGSFEIGNLLLIIFVSYFGTKLHRPIVIGIGCVVMGLGCFLKSLPHFLMNQYEYESTVP
VSGNLSSNSFLCMENGTQILRPTQDPSECTKEVKSLMWVYVLVGNIVRGMGETPILPLGI
SYIEDFAKFENSPLYIGLIETGAIIGPLIGLLLASFCANVYVDTGSVNTDDLTITPTDTR
WVGAWWFGFLICAGVNVLTAIPFFFLPKTLPKEGLENNADIIKNENEDKQREEVKKEKYG
ITKDFLPFMKSLSCNPIYMLFILVSVIQFNAFVNMISFMPKYLEQQYGISSSDAIFLMGI
YNLPPICIGYIIGGLIMKKFKITVKQAAHIGCWLSLLEYLLYFLSFLMTCENSSVVGINT
SYEGIPQDLYMENNIFADCNVDCNCPSKRWDPVCGNNGLSYLSACLAGCETSIGMGINMV
FQNCSCIQTSGNSSAVLGLCDKGPNCSMMLQYFLILSAMSSFVYSLAAIPGYMVLLRCMK
SEEKSLGVGLHTFCTRVFAGIPAPIYFGALMDSTCLHWGTLKCGESGACRIYDSTTFRYI
YLGLPAALRGSSFVPALIILILLRKCHLPGENASSGTELIETKVKGKENECKDIYQKSTV
LKDDELKIKL
Download sequence
Identical sequences G1QXW4
XP_003265631.1.23891 XP_012357779.1.23891 ENSNLEP00000005785 ENSNLEP00000005785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]