SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005802 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000005802
Domain Number 1 Region: 164-264
Classification Level Classification E-value
Superfamily Immunoglobulin 5.05e-23
Family I set domains 0.011
Further Details:      
 
Domain Number 2 Region: 80-172
Classification Level Classification E-value
Superfamily Immunoglobulin 1.53e-18
Family I set domains 0.019
Further Details:      
 
Domain Number 3 Region: 2-84
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000351
Family V set domains (antibody variable domain-like) 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005802   Gene: ENSNLEG00000004790   Transcript: ENSNLET00000006106
Sequence length 311
Comment pep:known_by_projection supercontig:Nleu1.0:GL397284.1:22223475:22521596:-1 gene:ENSNLEG00000004790 transcript:ENSNLET00000006106 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VRCVVEDKNSKVAWLNRSGIIFAGHDKWSLDPRVELEKRHSLEYSLRIQKVDVYDEGSYT
CSVQTQHEPKTSQVYLIVQVPPKISNISSDVTVNEGSNVTLVCMANGRPEPVITWRHLTP
TGREFEGEEEYLEILGITREQSGKYECKAANEVSSADVKQVKVTVNYPPTITESKSNEAT
TGRQASLKCEASAVPAPDFEWYRDDTRINSANGLEIKSTEGQSSLTVTNVTEEHYGNYTC
VAANKLGVTNASLVLFKRVLPTIPHPIQEIGTTVHFKQKGPGSVRGINGSISLAVPLWLL
AASLLCLLSKC
Download sequence
Identical sequences F7A360 G7MKD1 G7NXM7
ENSGGOP00000009380 ENSGGOP00000009380 ENSNLEP00000005802 ENSCJAP00000016798 ENSCJAP00000016798 ENSNLEP00000005802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]