SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005810 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000005810
Domain Number 1 Region: 3199-3463
Classification Level Classification E-value
Superfamily YWTD domain 5.49e-53
Family YWTD domain 0.00000262
Further Details:      
 
Domain Number 2 Region: 396-657
Classification Level Classification E-value
Superfamily YWTD domain 3.66e-45
Family YWTD domain 0.00000878
Further Details:      
 
Domain Number 3 Region: 711-963
Classification Level Classification E-value
Superfamily YWTD domain 2.75e-43
Family YWTD domain 0.0000175
Further Details:      
 
Domain Number 4 Region: 1438-1699
Classification Level Classification E-value
Superfamily YWTD domain 4.05e-43
Family YWTD domain 0.0000101
Further Details:      
 
Domain Number 5 Region: 2389-2632
Classification Level Classification E-value
Superfamily YWTD domain 8.5e-38
Family YWTD domain 0.0000189
Further Details:      
 
Domain Number 6 Region: 1746-2012
Classification Level Classification E-value
Superfamily YWTD domain 1.26e-36
Family YWTD domain 0.0000889
Further Details:      
 
Domain Number 7 Region: 2065-2334
Classification Level Classification E-value
Superfamily YWTD domain 4.32e-36
Family YWTD domain 0.0000305
Further Details:      
 
Domain Number 8 Region: 4055-4326
Classification Level Classification E-value
Superfamily YWTD domain 5.23e-36
Family YWTD domain 0.0000261
Further Details:      
 
Domain Number 9 Region: 305-385,650-706
Classification Level Classification E-value
Superfamily Growth factor receptor domain 7.06e-16
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 10 Region: 1353-1430,1691-1738
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000439
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 11 Region: 2735-2776
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000183
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 12 Region: 1065-1103
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000327
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 13 Region: 3144-3192
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000046
Family EGF-type module 0.0066
Further Details:      
 
Domain Number 14 Region: 2987-3028
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000537
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 15 Region: 3627-3666
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000759
Family LDL receptor-like module 0.00066
Further Details:      
 
Domain Number 16 Region: 1147-1184
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000117
Family LDL receptor-like module 0.0009
Further Details:      
 
Domain Number 17 Region: 2857-2896
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000122
Family LDL receptor-like module 0.00059
Further Details:      
 
Domain Number 18 Region: 1265-1306
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000144
Family LDL receptor-like module 0.0009
Further Details:      
 
Domain Number 19 Region: 3026-3066
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000209
Family LDL receptor-like module 0.00076
Further Details:      
 
Domain Number 20 Region: 3510-3546
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000314
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 21 Region: 3718-3755
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000406
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 22 Region: 3793-3833
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000419
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 23 Region: 3069-3109
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000445
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 24 Region: 26-63
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000759
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 25 Region: 103-147
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000916
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 26 Region: 3758-3795
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000106
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 27 Region: 2699-2741
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000119
Family LDL receptor-like module 0.00071
Further Details:      
 
Domain Number 28 Region: 2904-2939
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.00058
Further Details:      
 
Domain Number 29 Region: 3841-3878
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.00093
Further Details:      
 
Domain Number 30 Region: 182-217
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.00096
Further Details:      
 
Domain Number 31 Region: 216-256
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000017
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 32 Region: 1106-1143
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000017
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 33 Region: 1023-1060
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000196
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 34 Region: 3585-3629
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000034
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 35 Region: 3111-3159
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000051
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 36 Region: 1186-1224
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000563
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 37 Region: 65-101
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000772
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 38 Region: 1229-1265
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000838
Family LDL receptor-like module 0.00075
Further Details:      
 
Domain Number 39 Region: 3547-3588
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000209
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 40 Region: 3926-3962
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000249
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 41 Region: 264-300
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000249
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 42 Region: 2820-2859
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000249
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 43 Region: 1310-1346
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000681
Family LDL receptor-like module 0.003
Further Details:      
 
Domain Number 44 Region: 3882-3920
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000681
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 45 Region: 2018-2067
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000893
Family EGF-type module 0.023
Further Details:      
 
Domain Number 46 Region: 2943-2986
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000275
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 47 Region: 3681-3714
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000314
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 48 Region: 4007-4041
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000449
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 49 Region: 146-180
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000223
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 50 Region: 4381-4414
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000523
Family EGF-type module 0.02
Further Details:      
 
Domain Number 51 Region: 2783-2817
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000524
Family LDL receptor-like module 0.0022
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000005810
Domain Number - Region: 3969-4008
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000124
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 2341-2385
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000209
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 3468-3529
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00254
Family EGF-type module 0.034
Further Details:      
 
Domain Number - Region: 979-1019
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00365
Family EGF-type module 0.013
Further Details:      
 
Domain Number - Region: 4335-4361
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00898
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 2654-2714
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0618
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005810   Gene: ENSNLEG00000004701   Transcript: ENSNLET00000006115
Sequence length 4507
Comment pep:known_by_projection supercontig:Nleu1.0:GL397263.1:12728806:12960264:-1 gene:ENSNLEG00000004701 transcript:ENSNLET00000006115 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRGPAAVACTLLLALVACLAPASGQECDSEHFRCGSGHCIPADWRCDGTKDCSDDADEI
GCAVVTCQQGYFRCQSEGQCIPNSWVCDQDQDCDDGSDERQDCSQNTCSSHQITCSNGQC
IPSEYRCDHVRDCPDGADENDCQYPTCEQLTCDNGACYNTSQKCDWKVDCRDSSDEVNCT
EICLHNEFSCGSGECIPRAYVCDHDNDCQDGSDEHACNYPTCGGHQFTCPSGRCIYQNWV
CDGEDDCKDNGDEDGCESSPHDVHKCSPREWSCPESGRCISIYKVCDGILDCPGREDENS
TTTGKYCSTTLCSALNCQYQCHETPYGGACFCPPGYIINHNDSRTCVEFDDCQIWGICDQ
KCESRPGHHLCHCEEGYILERGQYCKANNSFGEASIIFSNGRDLLIGDIHGRSFRILVES
QNRGVAVGVAFHYHLQRVFWTDTVQNKVFSVDINGLNIQEVLNVSVETPENLAVDWVNNK
IYLVETKVNRIDMVNLDGSYRVTLITENLGHPRGIAVDPTVGYLFFSDWESLSGEPKLER
AFMDGSNRKDLVKTKLGWPAGVTLDTISKRVYWVDSRFDYIETVTYDGIQRKTVVHGGSL
IPHPFGISLFEGQVFFTDWTKMAVLKANKFTETNPQVYYQASLRPYGVTVYHSLRQPYAT
NPCKDNNGGCEQVCVLSHRTDNDGLGFRCKCTFGFQLDTDERRCTAVQNFLIFSSQVAIR
GIPFTLSTQEDVMVPVSGNPSFFVGIDFDAQDSSIFFSDMSKHMIFKQKIDGTGREILAA
NRVENVESLAFDWISKNLYWTDSHYKSISVMRLADKTRRTVVQYLNNPRSVVVHPFAGYL
FFTDWFRPAKIMRAWSDGSHLLPIVNTTLGWPNGLAIDWAASRLYWVDAYFDKIEHSTFD
GLDRRRLGHIEQMTHPFGLAIFGEYLFFTDWRLGAIIRVRKADGGEMTVIRSGIAYILHL
KSYDVNIQTGSNACNQPTHPNGDCSHFCFPVPNFQRVCGCPYGMKLASNHLTCEGDPTNE
PPTEQCGLFSFPCKNGRCVPNYYRCDGVDDCHDNSDEQLCGTLNNTCSSSAFTCGHGECI
PAHWRCDKRNDCVDGSDEHNCPTHAPASCLDTQYTCDNHQCISKNWVCDTDNDCGDGSDE
KNCNSTETCQPSQFNCPNHRCIDLSFVCDGDKDCVDGSDEVGCVLNCTASQFKCASGDKC
ISVTNRCDGVFDCSDNSDEAGCPTRPPGMCHSDEFQCQEDGICIPNFWECDGHPDCLYGS
DEHNACVPKTCPSSYFHCDNGNCIHRAWLCDRDNDCGDMSDEKDCPTQPFRCPSWQWQCL
GHNICVNLSVVCDGIFDCPNGTDESPLCNGNSCSDFNGGCTHECVQEPFGAKCLCPLGFL
LANDSKTCEDIDECDIPGSCSQHCYNMRGSFRCSCDTGYMLESDGRTCKVTASESLLLLV
ASQNKIIADSVTSQVHNIYSLVENGSYIVAVDFDSISGRIFWSDATQGKTWSAFQNGTDR
RVVFDSSIILTETIAIDWVGRNLYWTDYALETIEVSKIDGSHRTVLISKNLTNPRGLALD
PRMNEHLLFWSDWGHHPRIERASMDGSMRTVIVQDKIFWPCGLTVDYPNRLLYFMDSYLD
YMDFCDYNGHHRRQVIASDLIIRHPYALTLFEDSVYWTDRATRRVMRANKWHGGNQSVVM
YNIQWPLGIVAVHPSKQPNSVNPCAFSRCSHLCLLSSQGPHFYSCVCPSGWSLSPDLLNC
LRDDQPFLITVRQHIIFGISLNPDVRSNDAMVPIAGIQNGLDVEFDDAEQYIYWVENPGE
IHRVKTDGTNRTVFASISMVGPSMNLALDWISRNLYSTNPRTQSIEVLTLHGDIRYRKTL
IANDGTALGVGFPIGITVDPSRGKLYWSDQGTDSGVPAKIASANMDGTSVKTLFTGNLEH
LECVTLDIEEQKLYWAVTGRGVIERGNVDGTDRMILVHQLSHPWGIAVYDSFLYYTDEQY
EVIERVDKATGANKIVLRDNVPNLRGLQVYHRRNAAESSNGCSNNMNACQQICLPVPGGL
FSCACATGFKLNPDNRSCSPYNSFIVVSMLSAIRGFSLELSDHSETMVPVAGQGRNALHV
DVDVSSGFIYWCDFSSSVASDNAIRRIKPDGSSLTNIVTHGIGENGVRGIAVDWVAGNLY
FTNAFVSETLIEVLRINTTYRRVLLKVTVDMPRHIVVDPKNRYLFWADYGQRPKIERSFL
DCTNRTVLVSEGIVTPRGLAVDRSDGYVYWVDDSLDIIARIRINGENSEVIRYGSRYPTP
YGITVFENSIIWVDRNLKKIFQASKEPENTDPPTVIRDNINWLRDVTIFDKQVQRQSPAE
VNNNPCLENNGGCSHLCLALPGLHTPKCDCAFGTLQSDGKNCAISTENFLIFALSNSLRS
LHLDPENHSPPFQTINVERTVMSLDYDSVSDRIYFTQNLASGVGQISYVSLSSGIHTPTV
IASGIGTADGIAFDWITRRIYYSDYLNQTINSMAEDGSNRTVIARVPKPRAIVLDPCQGY
LYWADWDTHAKIERATLGGNFRVPIVNSSLVMPSGLTLDYEEDLLYWVDASLQRIERSTR
TGMDREVIVNAAVHAFGLTLYGQYIYWTDLYTQRIYRANKYDGSGQIAMTTNLLSQPRGI
NTVVKNQKQQCNNPCEQFNGGCSHICAPGPNGAECQCPHEGNWYLANNRKHCIVDNGERC
GASSFTCSNGRCISEEWKCDNDNDCGDGSDEMESVCALHTCLPTAFTCANGRCVQYSYRC
DYYNDCGDGSDEAGCLFRDCNATTEFMCNNRRCIPREFVCNGVDNCHDNNTSDEKNCPDR
TCQSGYTKCHNSNICIPRVYLCDGDNDCGDNSDENPTYCTTHTCSSSEFQCTSGRCIPQH
WYCDQETDCFDASDEPASCGHSERTCLADEFKCDGGRCIPSEWICDGDNDCGDMSDEDER
HQCQNQNCSDSEFLCVNDRPPDRRCIPQSWVCDGDVDCTDGYDENQNCTRRTCSENEFTC
GYGLCIPKIFRCDRHNDCGDYSDERGCLYQTCQQNQFTCQNGRCISKTFVCDEDNDCGDG
SDELMHLCHTPEPTCPPHEFKCDNGRCIEMMKLCNHLDDCLDNSDEKGCGINECHDPSIS
GCDHNCTDTLTSFYCSCRPGYKLMSDKRTCVDIDECTEMPFVCSQKCENVIGSYICKCAP
GYLREPDGKTCRQNSNIEPYLIFSNRYYLRNLTIDGYFYSLILEGLGNVVALDFDRVEKR
LYWIDTQRQVIERMFLNKTNKETVINHRLPAAESLAVDWVSRKLYWLDARLDGLFVSDLN
GGHRRMLAQHCVDANNTFCFDNPRGLALHPQYGYIYWADWGHRAYIGRVGMDGTNKSVII
STKLEWPNGITIDYTNDLLYWADAHLGYIEYSDLEGHHRHTVYDGALPHPFAITIFEDTI
YWTDWNTRTVEKGNKYDGSNRQTLVNTTHRPFDIHVYHPYRQPIVSNPCGTNNGGCSHLC
LIKPGGKGFTCECPDDFRTLQLSGSTYCMPMCSSTQFLCANNEKCIPIWWKCDGQKDCSD
GSDELALCPQRFCRLGQFQCNDGNCTSPQTLCNAHQNCPDGSDEDRLLCENHHCDSNEWQ
CANKRCIPESWQCDTFNDCEDNSDEDSSHCASRTCRPGQFRCANGRCIPQAWKCDVDNDC
GDHSDEPIEECMSSAHLCDNFTEFSCKTNYRCIPKWAVCNGVDDCRDNSDEQGCEERTCH
PVGDFRCKNHHCIPLRWQCDGQNDCGDNSDEENCAPRECTESEFRCVNQQCIPSRWICDH
YNDCGDNSDERDCEMRTCHPEYFQCTSGHCVPSELKCDGTADCLDASDEADCPTRFPDGA
YCQATMFECKNHVCIPPYWKCDGDDDCGDGSDEELHLCLNVPCNSPNRFRCDNNRCIYGH
EVCNGVDDCGDGTDETEEHCRKPTPKPCTEYEYKCGNGHCVPHDNVCDDADDCGDWSDEL
GCNKGKERTCAENICEQNCTQLNEGGFICSCTAGFETNVFDRTSCLDINECEQFGTCPQH
CRNTKGSYECVCADGFTSMSDRPGKRCAAEGNSPLLLLPDNVRIRKYNLSSERFSEYLQD
EEYIQAVDYDWDPEGIGLSVVYYTVRAEGSRFGAIKRAYIPNFESGRNNLVQEVDLKLKY
VMQPDGIAVDWVGRHIYWSDVKNKRIEVAKLDGRYRKWLISTDLDQPAAIAVNPKLGLMF
WTDWGKEPKIESAWMNGEDRNILVFEDLGWPTGLSIDYLNNDRLYWSDFKEDVIETIKCD
GTDRRVIAKEAMNPYSLDIFEDQLYWISKEKGEVWKQNKFGQGKKEKTLVVNPWLTQVRI
FHQLRYNKSVPNLCKQICSHLCLLRPGGYSCACPQGSTFIEGSTTECDAAIELPINLPPP
CRCMHGGNCYFDETDLPKCKCPSGYTGKYCEMAFSKGISPGTTAVAVLLTILLIVVIGAL
AIAGFFHYRRTGSLLPALPKLPSLSSLVKPSENGNGVTFRSGADLNMDIGVSGFGPETAI
DRSMAMV
Download sequence
Identical sequences ENSNLEP00000005810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]