SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005817 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000005817
Domain Number 1 Region: 27-143
Classification Level Classification E-value
Superfamily Immunoglobulin 1.71e-19
Family V set domains (antibody variable domain-like) 0.0055
Further Details:      
 
Domain Number 2 Region: 139-236
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000137
Family I set domains 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005817   Gene: ENSNLEG00000004791   Transcript: ENSNLET00000006123
Sequence length 430
Comment pep:known_by_projection supercontig:Nleu1.0:GL397284.1:25427922:25622288:-1 gene:ENSNLEG00000004791 transcript:ENSNLET00000006123 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLVELLLWWNCFSRTGVAASLEVSESPGSIQVARGQTAVLPCTFTTSAALINLNVIWMV
TPLSNANQPEQVILYQGGQMFDGAPRFHGRVGFTGTMPATNVSIFINNTQLSDTGTYQCL
VNNLPDIGGRNIGVTGLTVLVPPSAPHCQIQGSQDIGSDVILLCSSEEGIPRPTYLWEKL
DNTLKLPPTATQDQVQGTVTIRNISALSSGLYQCVASNAIGTSTCLLDLQVISPQPRNIG
LIAGAIGTGAVIIIFCIALILGAFFYWRSKNKEEEEEEIPNEIREDDLPPKCSSAKAFHT
EISSSDNNTLTSSNTYNSRYWSNNPKVHRNTESVNHFSDLGQSFSFHSGNANIPSIYANG
SHLIPGQHKTLVVTANRGSSPQVMSRSNGSVSRKPRPPHTHSYTISHATLERIGAVPVMV
PAQSRAGSLV
Download sequence
Identical sequences G1QXZ6
XP_003261891.1.23891 ENSNLEP00000005817 ENSNLEP00000005817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]