SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005818 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000005818
Domain Number 1 Region: 117-301
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.52e-59
Family SPRY domain 0.000000856
Further Details:      
 
Domain Number 2 Region: 33-105
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000328
Family RING finger domain, C3HC4 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005818   Gene: ENSNLEG00000004795   Transcript: ENSNLET00000006124
Sequence length 328
Comment pep:novel supercontig:Nleu1.0:GL397272.1:4543821:4547059:-1 gene:ENSNLEG00000004795 transcript:ENSNLET00000006124 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRLSLVTTNRLSPHGNFLPLCTFPLAVDMAALFQEASSCPVCSHYLEKPMSLECGCAVC
LKCINSLQKEPHGQDLLCCCCSMVSQRNKIRPNRHLERLVSHIKELEPKLKKILQMNPRM
RKFQVDMTLDADTANNFLLISDDLRSVRSGRIRQNRQDLAERFDFSICVLGSPRFTCGRH
YWEVDVGTSTEWDLGVCRESVHRKGRIQLTTERGFWTVSLRDGSRLSASTVPLTFLFVDR
KLQRVGIFLDMGMQNVSFFDAEGGSHVYTFRSVSAEEPLRPFLAPSIPPNGDQGVLSICP
VMNSGTTDAPIHPGEAKQTPTAKKQKIG
Download sequence
Identical sequences ENSNLEP00000005818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]