SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005842 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000005842
Domain Number 1 Region: 357-431
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000344
Family Third domain of FERM 0.0063
Further Details:      
 
Domain Number 2 Region: 79-130
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000209
Family Second domain of FERM 0.0078
Further Details:      
 
Domain Number 3 Region: 270-356
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000196
Family Second domain of FERM 0.0059
Further Details:      
 
Domain Number 4 Region: 209-259
Classification Level Classification E-value
Superfamily PH domain-like 0.00000669
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005842   Gene: ENSNLEG00000004819   Transcript: ENSNLET00000006151
Sequence length 432
Comment pep:known_by_projection supercontig:Nleu1.0:GL397360.1:3158800:3168260:1 gene:ENSNLEG00000004819 transcript:ENSNLET00000006151 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GVAPALFRGMPAHFSDSAQTEACYHMLSRPQPPPDPLLLQRLPRPSSLSDKTQLHSRWLD
SSRCLMQQGIKAGDVLWLRFKYYSFFDLDPKTDPVRLTQLYEQARWDLLLEEIDCTEEEM
MVFAALQYHINKLSQSGEVGEPAGTDPGLDDLDAALSNLEVKLEGSAPTDVLDSLTTIPE
LKDHLRIFRELEARVGSPAGGTTPSLPPGCEVVPDVNVSSQKFCIKLLVPSPEGMSEIYL
RCQDEQQYARWMAGCRLASKGRTMADSSYTSEVQAILAFLSLQRTGGGGPGNHPQGPDAS
AEGLNPYGLVAPRFQRKFKAKQLTPRILEAHQNVAQLSLAEAQLRFIQAWQSLPDFGISY
VMVRFKGSRKDEILGIANNRLIRIDLAVGDVVKTWRFSNMRQWNVNWDIRQVAIEFDEHI
NVAFSCVSASCR
Download sequence
Identical sequences ENSNLEP00000005842 ENSNLEP00000005842

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]