SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005897 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSNLEP00000005897
Domain Number - Region: 73-163
Classification Level Classification E-value
Superfamily Mediator hinge subcomplex-like 0.0068
Family CSE2-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005897   Gene: ENSNLEG00000004863   Transcript: ENSNLET00000006206
Sequence length 178
Comment pep:known_by_projection supercontig:Nleu1.0:GL397267.1:31452100:31477867:1 gene:ENSNLEG00000004863 transcript:ENSNLET00000006206 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTPPLAASGMAPGPFAGPQAQQAAREVNTASLCRIGQETVQDIVYRTMEIFQLLRNMQL
PNGVTYHTGTYQDRLTKLQDNLRQLSVLFRKLRLVYDKCNENCGGMDPIPVEQLIPYVEE
DGSKNDDRAGPPRFASEERREIAEVNKKLKQKNQQLKQIMDQLRNLIWDINAMLAMRN
Download sequence
Identical sequences A0A096NDR6 A0A0D9REQ4 A0A1D5R5X4 A0A2K5N1H6 A0A2K5RR47 A0A2K6A5B4 A0A2K6BHA6 A0A2K6L7B6 A0A2K6P151 G1QY76 G3R195 G7PCQ0 H2QWM0 Q96HR3 U3E850
ENSPTRP00000035106 ENSMMUP00000002765 ENSPTRP00000035106 ENSGGOP00000008950 ENSMMUP00000002765 gi|18087811|ref|NP_542382.1| ENSNLEP00000005897 ENSNLEP00000005897 9544.ENSMMUP00000002765 9598.ENSPTRP00000035106 9606.ENSP00000297347 ENSGGOP00000008950 ENSP00000297347 ENSP00000297347 ENSP00000297347 NP_001253026.1.72884 NP_542382.1.87134 NP_542382.1.92137 XP_002759320.1.60252 XP_003256197.1.23891 XP_003823376.1.60992 XP_004047511.1.27298 XP_005564026.1.63531 XP_007999607.1.81039 XP_010385175.1.97406 XP_011717071.1.29376 XP_011821523.1.47321 XP_011912794.1.92194 XP_017386170.1.71028 XP_017738194.1.44346 XP_528281.2.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]