SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005921 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000005921
Domain Number 1 Region: 234-314
Classification Level Classification E-value
Superfamily DEATH domain 0.000000000000121
Family DEATH domain, DD 0.024
Further Details:      
 
Domain Number 2 Region: 59-110
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000000000184
Family TNF receptor-like 0.0063
Further Details:      
 
Domain Number 3 Region: 130-187
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000000000128
Family TNF receptor-like 0.0021
Further Details:      
 
Domain Number 4 Region: 320-398
Classification Level Classification E-value
Superfamily DEATH domain 0.000000316
Family DEATH domain, DD 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005921   Gene: ENSNLEG00000004882   Transcript: ENSNLET00000006230
Sequence length 428
Comment pep:known_by_projection supercontig:Nleu1.0:GL397267.1:32967394:32996264:-1 gene:ENSNLEG00000004882 transcript:ENSNLET00000006230 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSARAAETHRSARPAAASKRLRFPGTTMNKLLCCALVFLDISIKWTTQETFPPKYLHYDE
ETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYV
KQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGSFSNE
TSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTLCEEAFFRFAVPT
KFTPNWLSVLVDNLPGTKVNAESVERIKRRHSSQEQTFQLLKLWKHQNKDQDIVKKIIQD
IDLCENSVQRHIGHANLTFEQLRSLMESLPGKKVGAEDIEKTTKACKSSDQILKLLSLWR
IKNGDQDTLKGLMHALKHSKTYHFPKTVTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQV
QSVKISCL
Download sequence
Identical sequences G1QYA0
XP_003256202.1.23891 ENSNLEP00000005921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]