SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005935 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000005935
Domain Number 1 Region: 106-203
Classification Level Classification E-value
Superfamily Fibronectin type III 7.99e-21
Family Fibronectin type III 0.0023
Further Details:      
 
Domain Number 2 Region: 201-304
Classification Level Classification E-value
Superfamily Fibronectin type III 7.62e-20
Family Fibronectin type III 0.00000339
Further Details:      
 
Domain Number 3 Region: 31-112
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000137
Family I set domains 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005935   Gene: ENSNLEG00000004878   Transcript: ENSNLET00000006244
Sequence length 372
Comment pep:known_by_projection supercontig:Nleu1.0:GL397291.1:23355091:23397085:1 gene:ENSNLEG00000004878 transcript:ENSNLET00000006244 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPVPWACCAVLAAAAAVVYAQRHSPQEAPHVQYERLGSDVTLPCGTANWDAAVTWRVN
GTDLAPDLLNGSQLVLRGLELGHSGLYACFHRDSWHLRHQVLLHVGLPPREPVLSCRSNT
YPKGFYCSWHLPTPTYIPNTFNVTVLHGSKIMVCEKDPALKNRCHIRYMHLFSTIKYKVS
ISVSNALGHNATAITFDEFTIVKPDPPENVVARPVPSNPRRLEVTWQTPSTWPDPESFPL
KFFLRYRPLILDQWQHVELSDGTAHTITDAYAGKEYIIQVAAKDNEIGTWSDWSVAAHAT
PWTEEPRHLTTEAQAAETTTSTTSSLAPPPTTKICDPGELGSGGGPNAPFSVSVPVTLAL
AAAAATANSLLI
Download sequence
Identical sequences G1QYB4
ENSNLEP00000005935 XP_003263441.1.23891 XP_003263442.1.23891 XP_004088842.1.23891 ENSNLEP00000005935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]