SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005947 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000005947
Domain Number 1 Region: 147-463
Classification Level Classification E-value
Superfamily Cysteine proteinases 3.76e-130
Family Transglutaminase core 0.00000000721
Further Details:      
 
Domain Number 2 Region: 3-146
Classification Level Classification E-value
Superfamily E set domains 1.64e-41
Family Transglutaminase N-terminal domain 0.0002
Further Details:      
 
Domain Number 3 Region: 619-717
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 3.4e-27
Family Transglutaminase, two C-terminal domains 0.00021
Further Details:      
 
Domain Number 4 Region: 506-617
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 8.79e-27
Family Transglutaminase, two C-terminal domains 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005947   Gene: ENSNLEG00000004887   Transcript: ENSNLET00000006256
Sequence length 720
Comment pep:known_by_projection supercontig:Nleu1.0:GL397306.1:4184143:4220286:-1 gene:ENSNLEG00000004887 transcript:ENSNLET00000006256 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQGLEVALTDLQSSRNNVRHHTEEITVDHLLVRRGQAFNLTLYFRNRGFQPGLDNIIFV
VETGPLPDLALGTRAVFSLARHHSPSPWIAWLENSGATSTEVSLCAPPTAAVGRYLLKIH
IDSFQGSVTAYQLGEFILLFNPWCPEDAVYLDSEPQRQEYVMNDYGFIYQGSKNWIRPCP
WNYGQFEDKIIDICLKLLDKSLHFQTDPATDCALRGSPVYVSRVVCAMINSNDDNGVLNG
NWSENYTDGTNPAEWTGSVAILKQWYATGCQPVRYGQCWVFAAVMCTVMRCLGIPTRVIT
NFDSGHDTDGNLIIDEYYDNTGRILGNKKKDTIWNFHVWNECWMARKDLPPGYGGWQVLD
ATPQEMSNGVYCCGPASVRAIKEGEVDLNYDTPFVFSMVNADCMSWLIQGGKEQKLHQDT
SSVGNFISTKSIQSDERDDITENYKYEEGSLQERQVFLKALQKLKARRFHGPQRGAELQP
SRPTPLSRDSPRSLHTPSRRPSDVVQVSLKFKLLDPPNMGQDICFVLLALNMSSQFKDLK
VNLSAQSLLHDGSPLSPFWQDIVFITLSPKEAKTYPCKISYSQYSQYLSTDKLIRISALG
EEKSSPEKILVNKIITLSYPSITINVLGAAIVNQPLSIQVIFSNPLSEQVEDCVLTMEGS
GLFKKQQKVFLGVLKPQHRASIILETVPFKSGQRQIQANMRSNKFKDIKGYRNVYVDFAL
Download sequence
Identical sequences G1QYC6
XP_003266844.1.23891 ENSNLEP00000005947 ENSNLEP00000005947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]