SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005948 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000005948
Domain Number 1 Region: 33-143
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-36
Family Spermadhesin, CUB domain 0.00025
Further Details:      
 
Domain Number 2 Region: 295-415
Classification Level Classification E-value
Superfamily TIMP-like 1.57e-35
Family Netrin-like domain (NTR/C345C module) 0.00031
Further Details:      
 
Domain Number 3 Region: 154-267
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-33
Family Spermadhesin, CUB domain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005948   Gene: ENSNLEG00000004883   Transcript: ENSNLET00000006257
Sequence length 415
Comment pep:known_by_projection supercontig:Nleu1.0:GL397300.1:19127419:19200311:-1 gene:ENSNLEG00000004883 transcript:ENSNLET00000006257 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGANAWTPLCLLLAAATQLSRQQSPERPVFTCGGILTGESGFIGSEGFPGVYPPNSKCT
WKITVPEGKVVVLNFRFIDLESDNLCRYDFVDVYNGHANGQRIGRFCGTFRPGALVSSGN
KMMVQMISDANTAGNGFMAMFSAAEPNERGDQYCGGRLDRPSGSFKTPNWPDRDYPAGVT
CVWHIVAPKNQLIELKFEKFDVERDNYCRYDYVAVFNGGEVNDARRIGKYCGDSPPAPIV
SERNELLIQFLSDLSLTADGFIGHYKFRPKKLPTTTAQPVTTTFPVTTGLKPTVALCQQK
CRRTGTLEGNYCSSDFVLAGTVITTITRDGSLHATVSIINIYKEGNLAIQQAGKNMSARL
TVVCKQCPLLRRGLNYIIMGQVGEDGRGKIMPNSFIMMFKTKNQKLLDALKNKQC
Download sequence
Identical sequences G1QYC7
ENSNLEP00000005948 ENSNLEP00000005948 XP_003265387.1.23891 XP_012364048.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]