SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005952 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000005952
Domain Number 1 Region: 33-114
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000659
Family Growth factor receptor domain 0.0052
Further Details:      
 
Domain Number 2 Region: 206-249
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000314
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005952   Gene: ENSNLEG00000004910   Transcript: ENSNLET00000006261
Sequence length 357
Comment pep:known_by_projection supercontig:Nleu1.0:GL397267.1:33459500:33467618:1 gene:ENSNLEG00000004910 transcript:ENSNLET00000006261 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRVQSTSFCLRKQCLCLTFLLLHLLGQVAATQLCPPQCPGQCPVTPPTCAPGVRAVLDG
CSCCLVCARQRGESCSDLEPCDESSGLYCDRSADPSNQTGICMAVEGDNCVFDGVIYRSG
EKFQPSCKFQCTCRDGQIGCVPRCQLDVLLPEPNCPAPRKVEVPGECCEKWICGPDEEDS
LGGLTLAAYRPEATLGVEVSDSSVNCIEQTTEWTACSKSCGMGFSTRVTNRNRQCEMLKQ
TRLCMVRPCEQEPEQPTDKKGKKCLRTKKSLKAIHLQFKNCTSLHTYKPRFCGVCSDGRC
CTPHNTKTIQAEFQCSPGQIVKKPVMVIGTCTCHTNCPKNNEAFLQELELKTTRGKM
Download sequence
Identical sequences G1QYD1
XP_003256204.1.23891 ENSNLEP00000005952 ENSNLEP00000005952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]