SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005958 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000005958
Domain Number 1 Region: 26-205
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 8.59e-82
Family MHC antigen-recognition domain 0.0000000485
Further Details:      
 
Domain Number 2 Region: 208-300
Classification Level Classification E-value
Superfamily Immunoglobulin 1.2e-31
Family C1 set domains (antibody constant domain-like) 0.0000141
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005958   Gene: ENSNLEG00000004728   Transcript: ENSNLET00000006267
Sequence length 365
Comment pep:known_by_projection supercontig:Nleu1.0:GL397342.1:6675604:6713618:1 gene:ENSNLEG00000004728 transcript:ENSNLET00000006267 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VGVMAPRTLLLLLSGALAVTETWAGSHSLRYFSTAVSRPGRGEPRYIAVEYVDDTQFLRF
DSDAAIPRMEPRAQWVEQEGPQYWERTTGYAKANAQTDRVALRNLLRRYNQSEAGSHTIQ
IMYGCDMGSDGRFLRGYRQDAYDGKDYISLNEDLRSWTAADTAAQITKHKWEAAGEAEQR
RAYLEGTCVEWLRRYLENGKEMLQRADPPKTHMTHHPISDHEATLRCWALGFYPAEITLT
WQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGKEQRYTCHVQHEGLPEPLTLRWEP
SSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRKGGSYSQAVSSDSAQGSDVSL
TACKV
Download sequence
Identical sequences ENSNLEP00000005958 ENSNLEP00000005958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]