SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005960 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000005960
Domain Number 1 Region: 148-465
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.46e-123
Family Transglutaminase core 0.00000000936
Further Details:      
 
Domain Number 2 Region: 5-147
Classification Level Classification E-value
Superfamily E set domains 8.75e-46
Family Transglutaminase N-terminal domain 0.00019
Further Details:      
 
Domain Number 3 Region: 608-705
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.57e-24
Family Transglutaminase, two C-terminal domains 0.00071
Further Details:      
 
Domain Number 4 Region: 487-605
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 3.92e-24
Family Transglutaminase, two C-terminal domains 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005960   Gene: ENSNLEG00000004914   Transcript: ENSNLET00000006269
Sequence length 710
Comment pep:known_by_projection supercontig:Nleu1.0:GL397306.1:4229696:4256620:-1 gene:ENSNLEG00000004914 transcript:ENSNLET00000006269 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQVATLQLESVDLQSSRNNKEHHTQEMGVKRLAVRRGQPFYIGLSFSRPFQSQSDHITF
VAETGPKPSELLGTRATFFLTRVRPGNVWGASDFTIDSNSLQVSLVTPANAVIGHYTLKI
EISQGQGHSVTYPLGTFIILFNPWSPEDDVYLPSEILLQEYIMRDYGFVYKGHEKFITSW
PWNYGQFEEDIIDICFEILNKSLYYLKNPAKDCSQRNDVVYVCRVVSAMINSNDDNGVLQ
GNWGEDYSNGVSPLEWNGSVAILRQWSASGGQPVKYGQCWVFASVMCTVMRCLGVPTRVV
SNFRSAHNVDRNLTIDTYYDRNAEMLSTQKRDKIWNFHVWNECWMIRKDLPPGYNGWQVL
DPTPQQTSSGLFCCGPASVKAIREGDVHLAYDTPFVYAEVNADEVIWLLGDGQAQEILAH
NTSSIGKEISTKMVGSDQRQSITSSYKYPEGSPEERAVFMKASRKMLGPQRASLPFLYLL
ESGGLRDQPAQLQLHLARIPEWGQDLQLLLRIRRVPDSTHPQGPIGLVVRFCAQALLHGG
GTQKPLWRHTLRLNLDFGKETQWPLLLPYSNYRNKLTDEKLIRVCGIAEVEETGRSMLVL
KEISLEPPHLSIEVSERAEVGKALRVHITLTNTLMVALSSCTMVLEGSGLVNGQIVKDLG
TLVAGHTLQIQLDLYPTKAGPRQLQVLISSNEVKEIKGYKDVFVTVAGAP
Download sequence
Identical sequences G1QYD9
ENSNLEP00000005960 ENSNLEP00000005960 XP_003266846.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]