SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005968 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000005968
Domain Number 1 Region: 370-536,616-730
Classification Level Classification E-value
Superfamily L domain-like 5.22e-51
Family Ngr ectodomain-like 0.0018
Further Details:      
 
Domain Number 2 Region: 140-347
Classification Level Classification E-value
Superfamily L domain-like 5.1e-41
Family Ngr ectodomain-like 0.00025
Further Details:      
 
Domain Number 3 Region: 1004-1178
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.15e-31
Family Laminin G-like module 0.0026
Further Details:      
 
Domain Number 4 Region: 1-109
Classification Level Classification E-value
Superfamily L domain-like 1.36e-26
Family Ngr ectodomain-like 0.0025
Further Details:      
 
Domain Number 5 Region: 845-970
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000143
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 6 Region: 816-856
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000168
Family EGF-type module 0.015
Further Details:      
 
Domain Number 7 Region: 773-815
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000433
Family EGF-type module 0.0068
Further Details:      
 
Domain Number 8 Region: 1274-1302
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000144
Family EGF-type module 0.021
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000005968
Domain Number - Region: 1233-1264
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000453
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005968   Gene: ENSNLEG00000004908   Transcript: ENSNLET00000006279
Sequence length 1381
Comment pep:known_by_projection supercontig:Nleu1.0:GL397318.1:13227948:13442369:-1 gene:ENSNLEG00000004908 transcript:ENSNLET00000006279 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLSENQIQGIPRKAFRGITDVKNLQLDNNHISCIEDGAFRALRDLEILTLNNNNISRILV
TSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLRQRRTVGQFTLCMAPVHLRGFNVADVQK
KEYVCPAPDSEPPSCNANSISCPSPCTCSNNIVDCRGKGLTEIPANLPEGIVEIRLEQNS
IKAIPAGAFTQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIAKGLFDGL
VSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFAPLQSIQTLHLAQNP
FVCDCHLKWLADYLQDNPIETSGARCSSPRRLANKRISQIKSKKFRCSGNQDYRSRFSSE
CFMDLMCPEKCRCEGTIVDCSNQKLARIPSHLPEYVTDLRLNDNEISVLEATGIFKKLPN
LRKINLSNNKIKEVREGAFDGAASVQELMLTGNQLETVHGRMFRGLSGLKTLMLRSNLIS
CVSNDTFAGLSSVRLLSLYDNRITTITPGAFTTLVSLSTINLLSNPFNCNCHLAWLGKWL
RKRRIVSGNPRCQKPFFLKEIPIQDVAIQDFTCDGNDESSCQLSPRCPEQCTCMETVVRC
SNKGLRALPRGMPKDVTELYLEGNHLTAVPRELSALRHLTLIDLSNNSISMLTNYTFSNM
SHLSTLILSYNRLRCIPVHAFNGLRSLRVLTLHGNDISSVPEGSFNDLTSLSHLALGTNP
LHCDCSLRWLSEWVKAGYKEPGIARCIVFRPLSPMGISTPTHRFQCKGPVDINIVAKCNA
CLSSPCKNNGTCTQDPVELYRCACPYSYKGKDCTVPINTCIQNPCQHGGTCHLSDSHKDG
FSCSCPLGFEGQRCEINPDDCEDNDCENNATCVDGINNYVCVCPPNYTGELCDDVIDHCV
ELNLCQHEAKCIPLDKGFRCECVPGYSGKLCETDNDDCVHKCRHGAQCVDTINGYTCTCP
QGFSGPFCEHPPPMVLLQTRPCDQYECRNGAPCHLVQQEPILPPPGFAGPRCEKLITVNF
VGKDSYVELASAKVRPQANISLQVATDKDNGILLYKGDNDPLALELYQGHVRLVYDSLSS
PPTTVYSVETVNDGQFHSVELVTLNQTLNLVVDKGTPKSLGKLQKQPAVGINSPLYLGGI
PTSTGLSALRQGTDRPLGGFHGCIHEVYITTHQTTFNSLSNYSFNKDLLRRSSTVSQPKL
TPEPTLEMCICVCRESSAAPTLIQFPSHPPLCPSCNHGNCVATGTSYMCKCAEGYGGALC
DNKNDSANACSAFKCHHGQCHISDQGEPYCLCQPGFSGEHCQQENPCLGQVVREVIRRQK
GYASCATASKVPIMECRGGCGPQCCQPTRSKRRKYVFQCTDGSSFVEEVERHLECGCLAC
S
Download sequence
Identical sequences ENSNLEP00000005968 ENSNLEP00000005968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]