SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000006009 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000006009
Domain Number 1 Region: 38-136
Classification Level Classification E-value
Superfamily Immunoglobulin 3.56e-17
Family V set domains (antibody variable domain-like) 0.00000818
Further Details:      
 
Domain Number 2 Region: 153-231
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000835
Family C2 set domains 0.00000852
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000006009   Gene: ENSNLEG00000004954   Transcript: ENSNLET00000006320
Sequence length 288
Comment pep:known_by_projection supercontig:Nleu1.0:GL397284.1:26032793:26067945:-1 gene:ENSNLEG00000004954 transcript:ENSNLET00000006320 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGHTRRQATSPFKCPYLNFFQLLVLAGLSCFCSGVIHVTKEVKEVATLSCGHNVSVEELA
QTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLK
YEKDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGE
ELNAINTTVSQDPETELYAVSSKLDFNMTSNHSFMCLIKYGHLRVNQTFNWNTPKQEHFP
DNLLPSWAITLISVNGIFVTCCLTYCFAPRCRERRRNERLRRESVRPI
Download sequence
Identical sequences G1QYI8
XP_003261902.1.23891 ENSNLEP00000006009 ENSNLEP00000006009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]