SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000006036 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000006036
Domain Number 1 Region: 31-122
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000468
Family V set domains (antibody variable domain-like) 0.00000956
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000006036   Gene: ENSNLEG00000004985   Transcript: ENSNLET00000006349
Sequence length 234
Comment pep:known_by_projection supercontig:Nleu1.0:GL397304.1:18569201:18580408:1 gene:ENSNLEG00000004985 transcript:ENSNLET00000006349 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKTRLWGLLWMLFVSELRAATKLTEEKYELKEGQTLDVKCDYTLEKFASSQKAWQIIRD
GEKPKTLACTERPSENSHPVQVGRIIMEDYHDHGLLHVRMTNLLVEDSGLYQCVIYQPPK
EPHMLFHRIRLVVTKGSSGTPGSNENSTQNVYKIPPTTTKALRPLYTRPRTVTQAPPKST
TDVSTPDSEINLTNVTDIIRVPVFNIVILVAGGFLSKSLVFSVLFAVTLRSFVP
Download sequence
Identical sequences G1QYL5
ENSNLEP00000006036 XP_003266345.1.23891 ENSNLEP00000006036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]