SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000006047 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000006047
Domain Number 1 Region: 89-181
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000095
Family V set domains (antibody variable domain-like) 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000006047   Gene: ENSNLEG00000004989   Transcript: ENSNLET00000006360
Sequence length 381
Comment pep:known_by_projection supercontig:Nleu1.0:GL397304.1:18602945:18619402:1 gene:ENSNLEG00000004989 transcript:ENSNLET00000006360 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNPCGWLGAVGPTLLHFPKWAASLLEPQVLPWQAQVAHPVSGGPSPWISRPDTAQLDGTM
APAFLLLLLLWPLGCVSGPSADSVYTKVRLLEGGTLSVQCSYKGYKNRVEGKVWCKIRKK
KCEPGFARVWVKGPRYLLQDDAQAKVVTITMVALKLQDSGRYWCMRNTSGILYPLMGIQL
DVSPAPKTERNTPFTHLANILKSGTATTGQAPTSGPDAPFTTGMMVFTPELVTLPRLLAS
TRPASKTGYSFTATSTTSQGPRRTTGSQTVTTSPSNARDSSAGPESVSTKSGHLSTRSPT
TGLCLTSRSLLNRLPSIPSIRHQDVYSTALVVVLIFLLVLMLIMVYGFWKKRHMASYSMC
SNPSRRDPPGRPEPYVEVCLI
Download sequence
Identical sequences ENSNLEP00000006047 ENSNLEP00000006047 XP_012351745.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]