SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000006051 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000006051
Domain Number 1 Region: 296-458
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.82e-47
Family SPRY domain 0.0000564
Further Details:      
 
Domain Number 2 Region: 72-137
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000702
Family B-box zinc-binding domain 0.0021
Further Details:      
 
Domain Number 3 Region: 9-84
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000858
Family RING finger domain, C3HC4 0.039
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000006051
Domain Number - Region: 121-241
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.000405
Family Apolipoprotein A-I 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000006051   Gene: ENSNLEG00000004987   Transcript: ENSNLET00000006364
Sequence length 465
Comment pep:known_by_projection supercontig:Nleu1.0:GL397342.1:6971952:6981436:1 gene:ENSNLEG00000004987 transcript:ENSNLET00000006364 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPATPSLKVVHELPACTLCAGPLEDAVTVPCGHTFCRLCLPALSQMGAQPSGKILLCPLC
QEEEQAETPMAPVPLGPLGETYCEEHGEKIYFFCENDAEFLCVFCREGPTHQAHTVGFLD
EAIQPYRDRLRSRLEALSMERDEIEDVKCREDQKLQVLLTQIESKKHQVETAFERLQQEL
EQQQCLLLARLRELEQQIWKERDEYITKVSEEVTRLGAQVKELEEKCQQPASELLQDVRV
NQSRCEMKTFVSPEAISPDLVKKIRDFHRKILTLPEMMRVFSENLAHHLEIDSGVITLDP
QTASRSLVLSEDRKSVRYTRQKKNLPDSPLRFDGLPAVLGFPGFSSGRHRWQVDLQLGDG
GGCTVGVAGEGVRRKGEMGLSAEDGVWAVIISHQQCWASTSPGTDLPLSEIPRGVSVALD
YEAGRVTLHNAQTQEPIFTFTASFSGKVFPFFAVWKKGSSLTLKG
Download sequence
Identical sequences G1QYN0
ENSNLEP00000006051 ENSNLEP00000006051 XP_012358612.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]