SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000006080 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000006080
Domain Number 1 Region: 20-112
Classification Level Classification E-value
Superfamily Immunoglobulin 4.33e-28
Family C1 set domains (antibody constant domain-like) 0.0000156
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000006080   Gene: ENSNLEG00000005023   Transcript: ENSNLET00000006393
Sequence length 215
Comment pep:known_by_projection supercontig:Nleu1.0:GL397342.1:7055482:7058345:1 gene:ENSNLEG00000005023 transcript:ENSNLET00000006393 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEWLRRHLENGKETLQRVDPPKAHVTQHPVSDHEATLRCWSLGFYPAEITLTWQQDGEDQ
TQDTEFVETRPAGDGNFEKWVAVVVPSGEEQRYKCHVQHEGLPEPLTLRWEPSSQPTIPI
VGIIAGLVLLGAVVTGVVVAAVMWRKKSSGSNCAQDSDESHEACKEDYACSCSGVWVLIS
FSSGCPSSLTAAGVIFPVIVPTRWKAVPAHRSLWY
Download sequence
Identical sequences ENSNLEP00000006080 ENSNLEP00000006080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]