SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000006082 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000006082
Domain Number 1 Region: 24-110
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000144
Family V set domains (antibody variable domain-like) 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000006082   Gene: ENSNLEG00000005007   Transcript: ENSNLET00000006395
Sequence length 311
Comment pep:known_by_projection supercontig:Nleu1.0:GL397304.1:18645471:18650492:1 gene:ENSNLEG00000005007 transcript:ENSNLET00000006395 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPNLLLLLLLGLEGQGIVGSLPEVLQAPVGSSILVQCHYRLQDVKAQKVWCRFLPEGCQ
PLVSSAVDRRAPAGRRTFLTDLGGGLLQVEMVTLQEEDAGEYGCMVDGARGPQILHRVSL
NILPPEEEEETYKIGSLAENAFSDPAGSANPLEPSQDEKSIPLIWGAVLLVGLLVAAVVL
FAVMAKRKQGNRLAVCGRFLSSRVSGMNPSSVVHHISDSGPAGALPLDVPHIRLDSEPSF
DNTTYTSLPLDSPSGKPSLPAPSSLPPLPPKVLVCSKPVTYATVIFPGGNKGGGASCGPA
QNPPNNQTPSS
Download sequence
Identical sequences G1QYR1
XP_003266350.1.23891 ENSNLEP00000006082 ENSNLEP00000006082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]