SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000006117 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000006117
Domain Number 1 Region: 63-242
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 1.54e-83
Family MHC antigen-recognition domain 0.0000000127
Further Details:      
 
Domain Number 2 Region: 245-336
Classification Level Classification E-value
Superfamily Immunoglobulin 1.37e-30
Family C1 set domains (antibody constant domain-like) 0.0000238
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000006117   Gene: ENSNLEG00000005053   Transcript: ENSNLET00000006432
Sequence length 346
Comment pep:known_by_projection supercontig:Nleu1.0:GL397342.1:7269491:7271939:1 gene:ENSNLEG00000005053 transcript:ENSNLET00000006432 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTQTQFSFPMGVGFLEKPMTPDYNKVPTQIQEALRTLTGIMADGTLLLLLLGALALTQTW
AGSHSLKYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDNDAASPRMEPRAPWMEQEGPDY
WDRETRSARDTAQTFRVNLRTLRGYYNQSKAGSHTLQWMHGCDLGSDGSFLRGYEQFAYD
GKDYLTLNEDLRSWTAVDPAAQISERKSNDACEAEHQRAYLEDTCVEWLRKYLEKGKETL
LRSDPPKTHVTHHHISDHEATLRCWALGFYPAEITLTWQRDGEDRTHNTELVETRPAGDG
TFQKWTAVVVPSGEEQRYTCHVQHEGLPEPLTLRWGKRGMGGHVSS
Download sequence
Identical sequences ENSNLEP00000006117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]