SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000006136 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000006136
Domain Number 1 Region: 41-272
Classification Level Classification E-value
Superfamily L domain-like 4.63e-36
Family Ngr ectodomain-like 0.0093
Further Details:      
 
Domain Number 2 Region: 299-382
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000064
Family I set domains 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000006136   Gene: ENSNLEG00000005073   Transcript: ENSNLET00000006452
Sequence length 522
Comment pep:known_by_projection supercontig:Nleu1.0:GL397300.1:22661332:22665456:-1 gene:ENSNLEG00000005073 transcript:ENSNLET00000006452 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLRVHTVPTLLGAVVRPGCRELLCLLMVTVTVGPGASGVCPTACICATDIVSCTNKNLS
KVPGNLFRLIKRLDLSYNRIGLLDCEWIPVSFAKLNTLILRHNNITSISTGSFSTTPNLK
CLDLSSNKLKTVKNAVFQELKVLEVLLLYNNHISYLDPSAFGGLSQLQKLYLSGNFLTQF
PMDLYVGRFKLAELMFLDVSYNRIPSMPMHHINLVPGKQLRGIYLHGNPFVCDCSLYSLL
VFWYRRHFSSVMDFKNDYTCRLWSDSRHSRQVLLLQDSFMNCSDSVINGSFRALGFIHEA
QVGERLMVHCDSKTGNANTDFIWVGPDNRLLEPDKEMENFHMFHNGSLIIESPRFEDAGV
YSCIAMNKQRLLNETVDVTINVSNFTVSRSHAHEAFNTAFTTLAACVASIVLVLLYLYLT
PCPCKCKTKRQKNMLHQSNAHSSILSPGPASDASTDERKAGAGKRVVFLEPLKDTAAGQN
GKVRLFPSEAVIAEGILKSTRGKSDSDSVNSVFSDTPFVASI
Download sequence
Identical sequences A0A2I3GIL1
XP_003265406.1.23891 XP_003265407.1.23891 XP_012364051.1.23891 ENSNLEP00000006136 ENSNLEP00000006136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]