SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000006182 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000006182
Domain Number 1 Region: 223-246
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000327
Family CCCH zinc finger 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000006182   Gene: ENSNLEG00000005104   Transcript: ENSNLET00000006498
Sequence length 253
Comment pep:known_by_projection supercontig:Nleu1.0:GL397342.1:7332903:7341320:1 gene:ENSNLEG00000005104 transcript:ENSNLET00000006498 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPTRTEGGSLLRNAAAADVLRNLPEVEWREPQHCCPPTPRKRKQNPRVPLPHYPPNPAAA
IAADTMPKRKKQNQHQPPTQQQPPLPEREETGDEEDGSPIGPPSLLGPPPMANGKPGDPK
SALHRGPPGSRGPLIPPLLSLPPPPWGRGPIRRGLGPRSSPYGRGWWGVNAEPPFPGPGH
GGPTRGSFHKEQRNPRRLKSWSLIKNTCPPKDDPQVMEDKSDRPVCRHFAKKGHCRYEDL
CAFYHPGVNGPPL
Download sequence
Identical sequences ENSNLEP00000006182 ENSNLEP00000006182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]