SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000006194 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000006194
Domain Number 1 Region: 32-96
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000000129
Family Ovomucoid domain III-like 0.0058
Further Details:      
 
Domain Number 2 Region: 139-220
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000317
Family S100 proteins 0.085
Further Details:      
 
Domain Number 3 Region: 226-267
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000262
Family VWC domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000006194   Gene: ENSNLEG00000005099   Transcript: ENSNLET00000006510
Sequence length 306
Comment pep:known_by_projection supercontig:Nleu1.0:GL397284.1:26857053:26912357:-1 gene:ENSNLEG00000005099 transcript:ENSNLET00000006510 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWKRWLALALVAVAWVRAEEELRSKSKICANVFCGAGRECAVTEKGEPTCLCIEQCKPHK
RPVCGSNGKTYLNHCELHRDACLTGSKIQVDYDGHCKEKKSVSPSASPVVCYQSNRDELR
RRIIQWLEAEIIPDGWFSKGSNYSEILDKYFKNFDNGDSRLDSSEFLKFVEQNETAINIT
TYPDQENNKLLRGLCVDALIELSDENADWKLSFQEFLKCLNPSFNPPEKKCALEDETYAD
GAETEVDCNRCVCACGNWVCTAMTCDGKNQKGAQTQTEEEMTRYVQELQKHQETAEKTKR
VSTKEI
Download sequence
Identical sequences A0A2K5ITH5 G1QZ23
XP_003261919.1.23891 XP_011796038.1.43180 ENSNLEP00000006194 ENSNLEP00000006194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]