SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000006205 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000006205
Domain Number 1 Region: 15-359
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 3.66e-74
Family Integrin alpha N-terminal domain 0.00000378
Further Details:      
 
Domain Number 2 Region: 360-520
Classification Level Classification E-value
Superfamily Integrin domains 1.99e-30
Family Integrin domains 0.0017
Further Details:      
 
Domain Number 3 Region: 523-661
Classification Level Classification E-value
Superfamily Integrin domains 2.2e-28
Family Integrin domains 0.004
Further Details:      
 
Domain Number 4 Region: 667-882
Classification Level Classification E-value
Superfamily Integrin domains 0.0000000000000188
Family Integrin domains 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000006205   Gene: ENSNLEG00000005089   Transcript: ENSNLET00000006521
Sequence length 934
Comment pep:known_by_projection supercontig:Nleu1.0:GL397269.1:25943442:26324606:1 gene:ENSNLEG00000005089 transcript:ENSNLET00000006521 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARGKNRGTSCGKTCREDRDDEWMGVSLARQPKADGRVLACAHRWKNIYYEADHILPHGF
CYIIPSNLQAKGRTLIPCYEEYKKKYGEEHGSCQAGIAGFFTEELVVMGAPGSFYWAGTI
KVLNLTDNTYLKLNDEVIMNRRYTYLGYAVTAGHFSHPSTTDVVGGAPQDKGIGKVYIFR
ADRRSGTLIKIFQASGKKMGSYFGSSLCAVDLNGDGLSDLLVGAPMFSEIRDEGQVTVYI
NRGNGALEEQLALTGDGAYNAHFGESIASLDDLDNDGFPDVAIGAPKEDDFAGAVYIYHG
DAGGIVPQYSMKLSGRKINPVLRMFGQSISGGIDMDGNGYPDVTVGAFMSDSVVLLRARP
VITVDVSIFLPGSINITAPQCHDGQQPVNCLNVTTCFSFRGKHVPGEIGLNYVLMADVAK
KEKGQLPRVYFVLLGETVGQVTEKLQLTYMEETCHHYVAHVKRRVQDVISPIVFEAAYSL
SEHVTGEEERELPPLTPVLRWKKGQKIAQKNQTVFERNCHSEDCAADLQLQGKLLLSSMD
DKTLYLALGAVKNISLNISISNLGDDAYDANVSFNVSRELFFINMWQKEEMGISCELLES
DFLKCSVGFPFMRSKSKYEFSVIFDTSHLSGEEEVLSFIVTAQSGNTERSESLHDNTLVL
MVPLMHEVDTSITGIMSPTSFVYGESVDAANFIQLDDLECHFQPINITLQVYNTGPSTLP
GSSVSISFPNRLSSGGAEMFHVQEMVVSQEKGNCSFQKNPTPCIIPQEQENIFHTIFAFF
TKSGRKVLDCEKPGISCLTAHCNFSALAKEESRTIDIYMLLNTEILKKDSSSVIQFMSRA
KVKVDPALRVVEIAHGNPEEVTVVFEALHNLEPRGYVVGWIIAISLLVGILIFLLLAVLL
WKMGFFRRRYKEIIEAEKNRKENEDSWDWVQKNQ
Download sequence
Identical sequences ENSNLEP00000006205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]