SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000006211 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000006211
Domain Number 1 Region: 345-637
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000192
Family Rhodopsin-like 0.029
Further Details:      
 
Domain Number 2 Region: 67-105
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000041
Family EGF-type module 0.012
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000006211
Domain Number - Region: 22-120
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00204
Family Growth factor receptor domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000006211   Gene: ENSNLEG00000005125   Transcript: ENSNLET00000006527
Sequence length 653
Comment pep:known_by_projection supercontig:Nleu1.0:GL397382.1:23607:79430:-1 gene:ENSNLEG00000005125 transcript:ENSNLET00000006527 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQGPLLLPGLCFLLSLFGAVTQKTKTSCAKCPANASCVNNTHCTCDHGYTSGSGQKLFTF
PLETCNDIDECKPPYSIYCGLNAACHNVEGSFYCHCIPGYQLLPRNEKFNNSNENICQDT
TSSKTTQGRKELQKIVDKFESFLTNQTLRSTEERQEISSTVTTILRDVESKVLETALKAP
EQKVLKIQNGSLAIETRVITDNCSEERKTFNLNVQMNSMDIGCNDIIQGDTQGPSAIAFI
SYSSLGNIINATFFEEMDKKDQVYLNSQVVSAAIGPKRNVSLSKSVTLTFQHVKVGGRPN
DVCVSSQAAGRSQEHLKCGCLMVPHYHWAWCLCLGCPVQESITVNFFSRSQKEDPVLTII
TYVGLSVSLLCLLLAALTFLLCKAIQNTSTSLHLHLSLCLFLAHLLFLVGIDRTEPKMLC
SIIAGALHYLYLAAFTWMLLEGLHLFLTARNLTVVNYSSINRLMKWIMFPVGYGVPAVTV
AISAASRPHLYGTADRCWLHLDQGFIWSFLGPVCAIFSVNLVLFILVFWILKRKLSSLNS
EVSTIQNTRMLAFKATAQLFILGCTWCLGLLQVGPAAQVMAYLFAIINSLQGFFIFLVYC
LLSQQVQKQYRKWFREIVKSKSESETYTLSSKMGPDSKPSEGDVFPGQVKIKY
Download sequence
Identical sequences ENSNLEP00000006211 ENSNLEP00000006211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]