SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000006233 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000006233
Domain Number 1 Region: 228-483
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.21e-63
Family Eukaryotic proteases 0.000000126
Further Details:      
 
Domain Number 2 Region: 46-163
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-23
Family Spermadhesin, CUB domain 0.00031
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000006233
Domain Number - Region: 190-236
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000105
Family Complement control module/SCR domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000006233   Gene: ENSNLEG00000005143   Transcript: ENSNLET00000006549
Sequence length 487
Comment pep:known_by_projection supercontig:Nleu1.0:GL397358.1:7038996:7051428:-1 gene:ENSNLEG00000005143 transcript:ENSNLET00000006549 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGPRVWGKYPCRSPHSTDCPGAMWWLLLWGVLQACPTRGSLLLAQELPQQLTSPGYPEP
YRKGQESSTDIKAPEGFAVSLIFQDFDLEPSQDCAGDSVTISGSGSDPSQFCGQQGSPLG
RPPGQREFISSGRSLRLTFRTQPSSENRTAHLHKGFLALYQTVAVNYSQPISEASRGSEA
INAPGDNPAKVQNHCQEPYYQAAAAGALTCATPGTWKDRQDGEEVLQCMPVCGRPVTPIA
QNQTTLGSSRAKLGNFPWQAFTSIHGRGGGALLGDRWILTAAHTIYPKDSVSLRKNQSVN
VFLGHTAIDEMLKLGNHPVHRVVVHPDYRQNESHNFSGDIALLELQHSIPLGPNVLPVCL
PDNETLYRSGLLGYVSGFGMEMGWLTTELKYSRLPVASREACNAWLQKRQRPEVFSDNMF
CVGDETQRPSVCQGDSGSVYVVWDDHAHHWVATGIVSWGIGCGEGYDFYTKVLSYVDWIK
GVMNGKN
Download sequence
Identical sequences G1QZ62
ENSNLEP00000006233 XP_003273827.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]