SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000006244 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000006244
Domain Number 1 Region: 30-116
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000014
Family V set domains (antibody variable domain-like) 0.0000124
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000006244
Domain Number - Region: 123-201
Classification Level Classification E-value
Superfamily Immunoglobulin 0.04
Family C2 set domains 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000006244   Gene: ENSNLEG00000005146   Transcript: ENSNLET00000006561
Sequence length 250
Comment pep:known_by_projection supercontig:Nleu1.0:GL397313.1:11927335:11988133:-1 gene:ENSNLEG00000005146 transcript:ENSNLET00000006561 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAGSDAGRALGVFGVVCLLHCFGFISCFPQPIYGVVYENVTFHVPSNMPLKEVLWKKQK
DKVAELENSEFRAFSSFKNRVYLDTVSGNLTIYNLTSSDEDEYEVESPNITDTLKFFLYV
LEPLPSPTLTCALTNGSIEVQCTIPKDYNSHRELTMYSWDCPMEQCKHNSTKIYFKMEND
RPQEIQCTASNPLFKRTSLISLTTCIPCSGHSRHRYALIPAPLAVIITCVMLYVNGILKC
DRKPDRTNSN
Download sequence
Identical sequences A0A2I3H9Z0
XP_003268085.2.23891 ENSNLEP00000006244 ENSNLEP00000006244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]