SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000006260 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000006260
Domain Number 1 Region: 129-206
Classification Level Classification E-value
Superfamily Immunoglobulin 1.47e-27
Family C2 set domains 0.0000121
Further Details:      
 
Domain Number 2 Region: 32-128
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000118
Family V set domains (antibody variable domain-like) 0.00000609
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000006260   Gene: ENSNLEG00000005167   Transcript: ENSNLET00000006577
Sequence length 351
Comment pep:known_by_projection supercontig:Nleu1.0:GL397313.1:12174368:12189647:1 gene:ENSNLEG00000005167 transcript:ENSNLET00000006577 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFPCKVVASFLLIFNVSSKGAVSKEITNALETWGALGQDINLDIPSFQMSDDIDDIKWE
KTSDKKKIAQFRKGKETFEEKDAYKLFKNGTLKIRHLKTDDQDIYKVSIYDTKGKNVLEK
TFDLKIQERVSKPKISWTCINTTLTCEVMNGTDPELNLYQDGKHLKLSQRVITHKWTTSL
SAKFKCTAGNKVSKESSVEPVSCPEKGLDIYLIIGICGGGSLLMVFVALLVFYITKRKKQ
RSRRNDEELETRAHRVATEERGRKPHQIPASTPQNSAASQHPPPPPGHRSQAPSHRPLPP
GHRVQHQPQKRPPAPSGTQVHQQKGPPLPRPRVQPKPPHGAAENSLSPSSN
Download sequence
Identical sequences G1QZ89
ENSNLEP00000006260 ENSNLEP00000006260 XP_003268087.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]