SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000006267 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000006267
Domain Number 1 Region: 315-472
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.97e-18
Family Clostridium neurotoxins, the second last domain 0.043
Further Details:      
 
Domain Number 2 Region: 133-243
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000123
Family Cadherin 0.0033
Further Details:      
 
Domain Number 3 Region: 25-145
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000257
Family Cadherin 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000006267   Gene: ENSNLEG00000005169   Transcript: ENSNLET00000006584
Sequence length 957
Comment pep:known_by_projection supercontig:Nleu1.0:GL397358.1:7072663:7100800:1 gene:ENSNLEG00000005169 transcript:ENSNLET00000006584 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLLLLPLLLASLLASCSCNKANKHKPWIEAEYQGIVMENDNTVLLNPPLFALDKDAPLR
YAGEICGFRLHGSGVPFEAVILDKATGEGLIRAKEPVDCEAQKEHTFTIQAYDCGEGPDG
ANTKKSHKATVHVRVNDVNEFAPVFVERLYRAAVTEGKLYDRILRVEAIDGDCSPQYSQI
CYYEILTPNTPFLIDNDGNIENTEKLQYSGERLYKFTVTAYDCGKKRAADDAEVEIQVKP
TCKPSWQGWNKRIEYAPGAGSLALFPGIRLETCDEPLWNIQATIELQTSHVAKGCDRDNY
SERALRKLCGAATGEVDLLPMPGPNANWTAGLSVHYSQDSSLIYWFNGTQAVQVPLGGPS
GLGSGPQDSLSDHFTLSFWMKHGVTPNKGKKEEETIVCNTVQNEDGFSHYSLTVHGCRIA
FLYWPLLESARPVKFLWKLEQVCDDEWHHYALNLEFPTVTLYTDGISFDPALIHDNGLIH
PPRREPALMIGACWTEEKNKEKEKGDNSTDTTQGIPCSSHPHFLGSSAGFWVSCGRSQES
DTQEGKVWASVKLAHIHPGLPARHWKDVHVNPSQSLLTLEGDDVETFNHALQHVAYMNTL
RFATPGVRPLRLTTAVKCFSEESCVSIPEVEGYVVVLQPDAPQILLSGTAHFARPAVDFE
GTEGVPLFPDLQITCSISHQVEAKKDESWQGTVTDTRMSDEIVHNLDGCEISLVGDDLDP
ERESLLLDTTSLQQRGLELTNTSAYLTIAGVESITVYEEILRQARYRLRHGAALYARKFR
LSCSEMNGRYSSNEFIVEVSVLHSMNRVAHPSHVLSSQQFLHRGHQPPPEMAGHSLASSH
RNSMIPSAATLIIVVCVGFLVLMVVLGLLRIHSLHRRVSGAGGPPGASSDPKDPDLFWDD
SALTIIVNPMESYQNRQPCVVGAAGGQQEDEDSSDSEVADSPSSDERRIIETPPHRY
Download sequence
Identical sequences ENSNLEP00000006267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]