SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000006272 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000006272
Domain Number 1 Region: 24-120
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000487
Family V set domains (antibody variable domain-like) 0.037
Further Details:      
 
Domain Number 2 Region: 283-381
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000549
Family V set domains (antibody variable domain-like) 0.032
Further Details:      
 
Domain Number 3 Region: 153-252
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000179
Family I set domains 0.089
Further Details:      
 
Domain Number 4 Region: 415-521
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000489
Family V set domains (antibody variable domain-like) 0.034
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000006272
Domain Number - Region: 696-805
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00109
Family V set domains (antibody variable domain-like) 0.049
Further Details:      
 
Domain Number - Region: 556-588,627-660
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00463
Family I set domains 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000006272   Gene: ENSNLEG00000005178   Transcript: ENSNLET00000006590
Sequence length 879
Comment pep:known_by_projection supercontig:Nleu1.0:GL397313.1:12322933:12401987:1 gene:ENSNLEG00000005178 transcript:ENSNLET00000006590 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRLASKPLLLALLSLALCRGRVVRVPTGTLVRVVGTELVIPCNVSDYDGPSEQNFDWSF
SSLGSSFVELASTWEVGFPAQLYQERLQRGEILLRRTANDAVELHIKNVQPSDQGHYKCS
TPSTDATVQGNYEDTVQVKVLADSLHVGPSARPPPSLSLREGEPFELRCTAASASPLHTH
LALLWEVHRGPARRSVLALTHEGRFHPGLGYEQRYHSGDVRLDTVGSDAYRLSVSRALSA
DQGSYRCIVSEWIAEQGNWQEIQEKAVEVATVVIQPTVLRAAVPKNVSVAEGKELDLTCN
ITTDRADDVRPEVTWSFSRMPDSTLPGSRMLARLDRDSLVHSSPHVALSHVDARSYHLLV
RDVSKENSGYYFCHVSLWAPGHNRSWHKVAEAVSSPAGVGVTWLEPEYQVYLNASKVPGF
ADDPTELACRVVDTKSGEVNVRFTVSWYYRMNRRSDNVVTSELLAVMDGDWTLKYGERSK
QRAQDGDFIFSKEHTDTFNFRIQRTTEEDRGNYYCVVSAWTKQRNNSWVKSKDVFSKPVN
IFWALEDSVLVVKARQPKPFFAAGNTFEMTCKVSSKNIKSPRYSVLITAEKPVGDLSSPN
ETKYIISLDQDSVVKLENWTDASRVDGVVLEKVQEDEFRYRMYQTQVSDAGLYRCMVTAW
SPVRGSLWREAATGLSNPIEIDFQTSGPIFNASVHSDTPSVIRGDLIKLFCIITVEGAAL
DPDDMAFDVSWFAVHSFGLDKAPVLLSSLDRKGIVTTSRRDWKSDLSLERVSVLEFLLQV
HGSEDQDFGNYYCSVTPWVKSPTGSWQKEAEIHSKPVFITVKMDVLNAFKYPLLIGVGLS
TVIGLLSCLIGYCSSHWCCKKEVQETRRERRRLMSMEMD
Download sequence
Identical sequences A0A2I3GND3
ENSNLEP00000006272 ENSNLEP00000006272 XP_003268089.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]