SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000006278 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000006278
Domain Number 1 Region: 1832-2110
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 9.05e-99
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000129
Further Details:      
 
Domain Number 2 Region: 517-704
Classification Level Classification E-value
Superfamily Fibronectin type III 1.21e-44
Family Fibronectin type III 0.00074
Further Details:      
 
Domain Number 3 Region: 1095-1280
Classification Level Classification E-value
Superfamily Fibronectin type III 5.18e-38
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 4 Region: 706-903
Classification Level Classification E-value
Superfamily Fibronectin type III 2.41e-37
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 5 Region: 245-296,380-504
Classification Level Classification E-value
Superfamily Fibronectin type III 1.32e-36
Family Fibronectin type III 0.00096
Further Details:      
 
Domain Number 6 Region: 907-1092
Classification Level Classification E-value
Superfamily Fibronectin type III 1.8e-29
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 7 Region: 1278-1467
Classification Level Classification E-value
Superfamily Fibronectin type III 2.2e-29
Family Fibronectin type III 0.0028
Further Details:      
 
Domain Number 8 Region: 4-57,117-242
Classification Level Classification E-value
Superfamily Fibronectin type III 4.1e-26
Family Fibronectin type III 0.0022
Further Details:      
 
Domain Number 9 Region: 1483-1582
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000385
Family Fibronectin type III 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000006278   Gene: ENSNLEG00000005154   Transcript: ENSNLET00000006596
Sequence length 2149
Comment pep:known_by_projection supercontig:Nleu1.0:GL397276.1:16217514:16425093:1 gene:ENSNLEG00000005154 transcript:ENSNLET00000006596 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSPAPGKVVNLTVEAYNSSAVKLIWYLPRQPNGKITSFKISVKHARSGIVVKDVSIRVED
ILTGKLPECNENSESFLWSTASPSPTLGRVTPPSRTTYSSSTLTQNEISSVWKEPISFVV
TNLRPYTTYLFEVSAVTTEAGYIDSTIVRTPESVPEGPPQNCVTGNITGKSFSILWDSPT
IVTGKFSYRVELYGPSGRILDNSTKDLKFAFANLTPFTMYDVYVAAETSAGTGPKSNLSV
FTPPDVPGAVFDLQLAEVEATQVRITWRKPRQPNGIINQYRVKVLVPETGIILENTLLTG
NNEYINDPMAPEIVNIVEPMVGLYEGSAEMSSDLHSLATFIYNSHPDNNFPARNRAEDQT
SPVVITRNQYITDIAAEQLSYVIRRLVPFTEHMISVSAFTIMGEGPPTVLSVRTREQVPS
SIKIINYKNISSSSILLYWDPPEYPNGKITHYTIYAMELDTNRAFQITTIDNSFLITGLK
KYTKYKMRVAASTHVGESSLSEENDIFVRTSEDEPESSPQDVEVIDVTADEIRLKWSPPE
KPNGIITAYEVLYKNIDTLHMKNTSTTDIILRNLRPHTLYNISVRSYTRFGHGNRVSSLL
SVRTSETVPDSAPENITYKNISSGEIELSFLPPSSPNGIIQKYTIYLKRSNGNEDRTINT
TSLTQNIKGLKKYTQYIIEVSASTLKGEGVRSAPISILTEEDAPDSPPQDFSVKQLSGVT
VKLSWQPPLEPNGIILYYTVYVWNRSSLKTINVTETSLELPDLDYNVEYSACVTASTRFG
DGKTRSNIISFQTPEGAPSDPPKDVYYVNLSSSSIILFWTPPSKPNGIIQYYSVYYRNTS
GTFMQNFTLHEVTNDFDNMTVSTIIDKLAIFSYYTFWLTASTSVGNGNKSSDIVEVYTDQ
DIPEGLVGNLTYESISSTAINVSWVPPAQPNGLVFYYVSLILQQTPRHVRPPLVTYERSI
YFDNLEKYTDYILKITPSTEKGFSDTYTTHLYIKTEEDVPETSPIINTFKNLSSTSVLLS
WDPPVKPNGAIISYDLTLQGPNENYSFITSDNYIILEELSPFTLYSFFAAARTIKGLGPS
SILFFYTDETVPLAPPQNLTLINCTSDFVWLKWSPSPLPGGIVKVYSFKIHEHETDTIYY
KNISGFKTEAKLVGLEPVSTYSIRVSAFTKVGNGNQFSNVVKFTTQESVPDVVQNMQCMA
TSWQSVLVKWDPPKKANGIITQYMITVERNSTKVSPQDHMYTFIKLLANTSYVFKVRAST
SAGEGDESTCHVSTLPETVPSVPTNIAFSDVQSTSATLTWIRPDTILGYFQNYKITTQLR
AQKCKEWESEECVEYQKIQYLYEANLTEETVYGLEKFRWYRFQVAASTNAGYGNASNWIS
TQTLPGPPDGPPENVHVVATSPFSISISWSEPAVITGPTCYLIDVKSVDNDEFNISFIKS
NEENKTIEIKDLEIFTRYSVVITAFTGNISAAYVEGKSSAEMIVTTLESAPKDPPNNMTF
QKIPDEVTKFQLTFLPPSQPNGNIQVYQALVYREDDPTAVQIHNLSIIQKTNTFVIAMLE
GLKGGHTYNISVYAVNSAGAGPKVPMRITMDIKAPARPKTKPTPIYDATGKLLVTSTTIT
IRMPICYYSDDHGPIKNVQVLVTETGAQHDGNVTKWYDAYFNKARPYFTNEGFPNPPCTE
GKTKFSGNEEIYIIGADNACMIPGNEDKICNGPLKPKKQYLFKFRATNVMGQFTDSDYSD
PVKTLGEGLSERTVEIILSVTLCILSIILLGTAIFAFARIRQKQKEGGTYSPRDAEIIDT
KFKLDQLITVADLELKDERLTRLLSYRKSIKPISKKSFLQHVEELCTNNNLKFQEEFSEL
PKVLQDLSSTDADLPWNRAKNRFPNIKPYNNNRVKLIVDASAPGSDYINASYISGYLCPN
EFIATQGPLPGTVGDFWRMVWETRAKTLVMLTQCFEKGRIRCHQYWPEDNKPVTVFGDIV
ITKLMEDVQTDWTIRDLKIERHGDCMTVRQCNFTAWPEHGVPENSAPLIHFVKLVRASRA
HDTTPMIVHCSAGVGRTGVFIALDHLTQHVNDHDFVDIYGLVAELRSERMCMVQNLAQYI
FLHQCILDLLSNKGSNRPICFVNYSALQKMDSLDAMEGDVELEWEETTM
Download sequence
Identical sequences ENSNLEP00000006278 ENSNLEP00000006278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]