SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000006292 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000006292
Domain Number 1 Region: 38-140
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000132
Family V set domains (antibody variable domain-like) 0.023
Further Details:      
 
Domain Number 2 Region: 837-926
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000407
Family V set domains (antibody variable domain-like) 0.028
Further Details:      
 
Domain Number 3 Region: 426-548
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000014
Family V set domains (antibody variable domain-like) 0.032
Further Details:      
 
Domain Number 4 Region: 165-272
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000176
Family V set domains (antibody variable domain-like) 0.029
Further Details:      
 
Domain Number 5 Region: 308-395
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000001
Family V set domains (antibody variable domain-like) 0.07
Further Details:      
 
Domain Number 6 Region: 696-801
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000024
Family V set domains (antibody variable domain-like) 0.076
Further Details:      
 
Domain Number 7 Region: 565-656
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000294
Family C1 set domains (antibody constant domain-like) 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000006292   Gene: ENSNLEG00000005188   Transcript: ENSNLET00000006613
Sequence length 1035
Comment pep:known_by_projection supercontig:Nleu1.0:GL397313.1:12419096:12455116:1 gene:ENSNLEG00000005188 transcript:ENSNLET00000006613 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLVTLLGRERTVLAQMAGISYVASFLFLTKLSIGQREVTVQKGPLFRAEGYPVSIGCNVT
GHQGPSEQHFQWSVYLLTNPTQEVQIISTKDAAFSYAVYTQRVRSGDIYVERVQGNSVLL
HISKLQMKDAGEYECHTPNTDEKYYGSYSAKTNLVVIPDTLSATMSSQTLGKEEGEPLAL
TCEASKATAQHTHLSVTWYLTQDGGGSQATEIISLSKDFILVPGPFYTERFAASDVQLNK
LGPTAFRLSIERLQSSDQGQLFCEATEWIQDPDENWMFITKKQTDQTTLRIQPAVKDFQV
NITADSLFAEGKPLELVCLVVGSGRDPQLQGIWFFNGTEIAHIDADGVLGLKNDYKERAS
QGELQVSKFGPKAFSLKIFSLGPEDEGDYRCVVAEVMKTHTGSWQVLQRKQSPDSHVHLR
KPAARSVVVYTKKKQQVVWEGETLTLLCKAGGAESPLSVSWWHIPRDQTQPEFVAGMGQD
GIVQLGASYGGPSYHGNTRLEKVDWATFQLEITFTAITDSGTYECRVSEKSQNQARDLSW
TQKISVTVKSLESSLQVSLMSRQPQVMLTSTFDLSCVVRAGYSDLKVPLTVTWQFQPASS
HIFHQLIRITHNGTIEWGNFLSQFQKKTKVSQSLFRSQLLVHDATEEETGVYQCEAEVYD
RNSLYNNHPPRASAISHPLRIAVTLPESKLKVNSRSQVQELSINSNTDIECSILSRSNGN
LQLAIIWYFSPISTNASWLKILEMDQTNVIKTGDEFHTPQRKQKFHTEKVSQDLFQLHIL
NVEDSDQGKYRCVVEEWLLSTNGTWYKLGEKKSGLTELKLKPTGSKVRVSKVYWTENVTE
HREVAIHCRLESVGSPAALYSVMWYWNRENSGSKMLVHLQHDGLLEYGEEGLRRHLHCYR
SSPTDFVLKLHQVEMEDAGMYWCRVAEWQLHGHPSKWINQASDESQRMALTVLPSEPTLP
SRICSSAPLLYFLFICPFVLLLLLLTSLLCLYWKARKLSTLHSSTQKEKALWVDLKEAGG
VTANRREDEEEDEGN
Download sequence
Identical sequences ENSNLEP00000006292 XP_003268090.1.23891 XP_004090021.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]