SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000006302 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000006302
Domain Number 1 Region: 41-86
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000000832
Family Ovomucoid domain III-like 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000006302   Gene: ENSNLEG00000005213   Transcript: ENSNLET00000006624
Sequence length 86
Comment pep:known_by_projection supercontig:Nleu1.0:GL397291.1:24408519:24416904:-1 gene:ENSNLEG00000005213 transcript:ENSNLET00000006624 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVRQWVITLALAALLVVDREVPVAAGKLPFSRMPICEHMVESPTCSQTSNLVCGTDGLT
YTNECQLCLARIKTKQNIQIMKDGKC
Download sequence
Identical sequences G1QZD1
ENSNLEP00000006302 ENSNLEP00000006302 XP_003263475.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]