SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000006308 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000006308
Domain Number 1 Region: 62-158
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 1.12e-17
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0061
Further Details:      
 
Domain Number 2 Region: 897-919
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000877
Family CCCH zinc finger 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000006308   Gene: ENSNLEG00000005196   Transcript: ENSNLET00000006630
Sequence length 927
Comment pep:known_by_projection supercontig:Nleu1.0:GL397342.1:7377785:7393407:-1 gene:ENSNLEG00000005196 transcript:ENSNLET00000006630 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSGPIDPKELLKGLDSFLNRDGEVKSVDGISKIFSLMKEARKMVSRCTYLNILLQTRSP
EILIKFIDVGGYKLLNNWLTYSKTTNNIPLLQQILLTLQHLPLTVDHLKQNNTAKLVKQL
SKSSEDEELRKLASVLVSDWMAVIRSQSSTQPAEKDKKKRKDEGKSRTTLPERPLTEVKA
ETRAEEAPEKKREKPKSLRTTAPSHAKFRSTGLELETPSLVPVKKNASTVVVSDKYNLKP
IPLKRQSNIAAPGDATPPAEKKYKPLNTTPNATKEIKVKIIPPQPMEGLGFLDALNSAPV
PGIKIKKKKKVLSPTAAKPSPFEGKTNTEPSTAKPSSPEPAPPSEAMDTDRPGTPVPPVE
VPELMDTASLEPGALDAKPVESPGDPNQLTRKGRKRKSVTWPEEGKLREYFYFELDETER
VNVNKIKDFGEAAKREILSDRHAFETARRLSHDNMEEKVPWVCPRPLVLPSPLVTPGSNS
QERYIQAEREKGILQELFLNKESPHEPDPEPYEPIPPKLIPLDEECSMDETPYVETLEPG
GSGGSPDGAGGSKLPPVLANLMGSMGAGKGPQGPGGGGGINVQEILTSIMGSPNSHPSEE
LLKQPDYSDKIKQMLVPHGLLGPGPIANGFPPGGPGGPKGMQHFPPGPGGPMPGPHGGPG
GPVGPRLLGPPPPPRGGDPFWDGPGDPMRGGPMRGGPGPGPGPYHRGRGGRGGNEPPPPP
PPFRGARGGRSGGGPPNGRGGPGGGMVGGGGHRPHEGPGGGMGNSSGHRPHEGPGGGMGG
GGGHRPHEGPGGGISGGSGHRPHEGPGGGMGAGGGHRPHEGPGGSMGGSGGHRPHEGPGH
GGPHGHRPHDVPGHRGHDHRGPPPHEHRGHDGPGHGGGGHRGHDGGHSHGGDMSNRPVCR
HFMMKGNCRYENNCAFYHPGVNGPPLP
Download sequence
Identical sequences G1QZD7
ENSNLEP00000006308 ENSNLEP00000023223 XP_012358586.1.23891 ENSNLEP00000006308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]