SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000006319 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000006319
Domain Number 1 Region: 91-170
Classification Level Classification E-value
Superfamily Ribosomal protein S18 3.79e-23
Family Ribosomal protein S18 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000006319   Gene: ENSNLEG00000005224   Transcript: ENSNLET00000006641
Sequence length 258
Comment pep:known_by_projection supercontig:Nleu1.0:GL397342.1:7394030:7402962:1 gene:ENSNLEG00000005224 transcript:ENSNLET00000006641 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASVLNTLLRRLPMLSLFRGTHRVQVPLQTLCTKAPSEEDSLSPVPISPYKDEPWKYLE
SEEYQERYGSRPVWADYRRNHKGGVPPQRTRKTCIRRNKVAGNPCPICRDHKLHVDFRNV
KLLEQFVCAHTGIIFHAPYTGVCVKQHKRLTQAIQKARDHGLLIYHIPQVEPRDLDFSTS
HGAVSATPPAPTLISGDPWYPWYNWKQPPERELSRLRRLYQGHLREESGPPPESMPKMPP
ATPAEASSTGQTDPQSAL
Download sequence
Identical sequences G1QZE8
ENSNLEP00000006319 XP_003272085.1.23891 ENSNLEP00000006319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]