SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000006366 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000006366
Domain Number 1 Region: 47-141
Classification Level Classification E-value
Superfamily Immunoglobulin 3.48e-16
Family V set domains (antibody variable domain-like) 0.0049
Further Details:      
 
Domain Number 2 Region: 162-236
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000017
Family I set domains 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000006366   Gene: ENSNLEG00000005256   Transcript: ENSNLET00000006691
Sequence length 282
Comment pep:known_by_projection supercontig:Nleu1.0:GL397313.1:12568180:12637499:-1 gene:ENSNLEG00000005256 transcript:ENSNLET00000006691 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASLGQILFWSIISIIIILAGAIALIIGFGISGRHSITVTTVASAGNIGEDGILSCTFEP
DIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNV
QLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVV
WASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKV
TESEIKRRSHLQLLNSKASLCVSSFFAISWALLPLTPYLMLK
Download sequence
Identical sequences A0A2J8SQK2 G1QZJ5
ENSNLEP00000006366 XP_003268097.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]