SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000006368 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000006368
Domain Number 1 Region: 43-137
Classification Level Classification E-value
Superfamily Immunoglobulin 3.48e-16
Family V set domains (antibody variable domain-like) 0.0049
Further Details:      
 
Domain Number 2 Region: 158-232
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000166
Family I set domains 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000006368   Gene: ENSNLEG00000005256   Transcript: ENSNLET00000006693
Sequence length 278
Comment pep:known_by_projection supercontig:Nleu1.0:GL397313.1:12568180:12599383:-1 gene:ENSNLEG00000005256 transcript:ENSNLET00000006693 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPLTSRIISIIIILAGAIALIIGFGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKL
SDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTD
AGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQ
VDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESE
IKRRSHLQLLNSKASLCVSSFFAISWALLPLTPYLMLK
Download sequence
Identical sequences ENSNLEP00000006368 XP_004090016.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]