SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000006430 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000006430
Domain Number 1 Region: 209-320
Classification Level Classification E-value
Superfamily Cadherin-like 1.2e-26
Family Cadherin 0.0000185
Further Details:      
 
Domain Number 2 Region: 429-557
Classification Level Classification E-value
Superfamily Cadherin-like 1.31e-23
Family Cadherin 0.00027
Further Details:      
 
Domain Number 3 Region: 322-434
Classification Level Classification E-value
Superfamily Cadherin-like 1.34e-23
Family Cadherin 0.000022
Further Details:      
 
Domain Number 4 Region: 111-207
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000761
Family Cadherin 0.0000191
Further Details:      
 
Domain Number 5 Region: 542-644
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000201
Family Cadherin 0.0000535
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000006430   Gene: ENSNLEG00000005301   Transcript: ENSNLET00000006757
Sequence length 829
Comment pep:known_by_projection supercontig:Nleu1.0:GL397289.1:21360646:21416492:1 gene:ENSNLEG00000005301 transcript:ENSNLET00000006757 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLPRGPLASLLLLQVCWLQCAASEPCRAVFGEAEVTLEAGGAKQHPGQALGKVFMGCPG
QEPALFSTDNDDFTVRNGETIQERRSLKERNPLKIFPSKRILRRHKRDWVVAPISVPENG
KGPFPQRLNQLKSNKDRDTKIFYSITGPGADSPPEGIFAVEKETGWLLLNKPLDREEIAK
YELFGHAVSENGASVEDPMNISIIVTDQNDHKPKFTQDTFRGSVLEGVLPGTSVMQVTAT
DEDDAIHTYNGVVAYSIHSQEPKDPHDLMFTIHRSTGTISVISSGLDREKVPEYTLTIQA
TDMDGDGSTTTAVAVVEILDANDNAPVFDPRKYEARVPENAVGHEVQRLTVTDLDAPNSP
AWCATYLIVGGDDGDHFTITTHPESNQGILTTRKGLDFEAKNQHTLYIEVTNEAPFGLKL
PTSTATVVVHVEDVNEAPVFVPPSKVVEVQEGIPTGEPVCVYTAKDPDKENQKISYRILR
DPAGWLAMDPDSGQVTAVGTLDREDERFVRNNIYEVMVLAMDDGSPPTTGTGTLLLTLID
VNDHGPVPEPRQITICNQSPVPQVLNITDKDLSPHTSPFQAQLTEDSDIYWMAEVNDKGD
TVVLSLKKFLKQDTYDVHLSLSDHGNKEQLTVIRATVCDCHGHVKTCPPRWKGGFILPVL
GAVLALLFLLLVLLLLVRKKRKVKEPLLLPEDDTRDNVFYYGEEGGGEEDQDYDITQLHR
GLEARPEVVLRNDVAPTFIPTPMYRPRPANPDEIGNFIIENLKAANTDPTAPPYDSLLVF
DYEGSGSDAASLSSLTSSASDQDQDYDYLNKWGSRFKKLADMYGGGEDD
Download sequence
Identical sequences G1QZQ9
XP_004087348.1.23891 ENSNLEP00000006430 ENSNLEP00000006430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]