SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000006463 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000006463
Domain Number 1 Region: 20-135
Classification Level Classification E-value
Superfamily DEATH domain 1.32e-26
Family DEATH domain, DD 0.0036
Further Details:      
 
Domain Number 2 Region: 173-315
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 3.79e-26
Family Toll/Interleukin receptor TIR domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000006463   Gene: ENSNLEG00000005333   Transcript: ENSNLET00000006791
Sequence length 317
Comment pep:known_by_projection supercontig:Nleu1.0:GL397269.1:26628037:26632586:1 gene:ENSNLEG00000005333 transcript:ENSNLET00000006791 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPDRAEAPGQPAMAAGGPGAGSAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADW
TALAEEMDFEYLEIRQLETHADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGP
SIEEDCQKYILKQQQEEAEKPLQVAAVDSSVPRTAELAGITTLDDPLGHMPERFDAFICY
CPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRLARRPRGGCRRM
VVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNP
CTKSWFWTRLAKALSLP
Download sequence
Identical sequences A0A2J8WYD7 G1QZU2
ENSNLEP00000006463 XP_003256907.1.23891 ENSNLEP00000006463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]