SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000006507 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000006507
Domain Number 1 Region: 250-388
Classification Level Classification E-value
Superfamily Cadherin-like 1.44e-32
Family Cadherin 0.00000679
Further Details:      
 
Domain Number 2 Region: 27-173
Classification Level Classification E-value
Superfamily Cadherin-like 2.57e-24
Family Cadherin 0.0021
Further Details:      
 
Domain Number 3 Region: 496-623
Classification Level Classification E-value
Superfamily Cadherin-like 1.31e-23
Family Cadherin 0.00016
Further Details:      
 
Domain Number 4 Region: 159-254
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000484
Family Cadherin 0.00000195
Further Details:      
 
Domain Number 5 Region: 369-501
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000117
Family Cadherin 0.0000822
Further Details:      
 
Domain Number 6 Region: 610-712
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000691
Family Cadherin 0.0000605
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000006507   Gene: ENSNLEG00000005326   Transcript: ENSNLET00000006836
Sequence length 903
Comment pep:known_by_projection supercontig:Nleu1.0:GL397289.1:21448380:21554685:1 gene:ENSNLEG00000005326 transcript:ENSNLET00000006836 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPWSLSLSALLLLLQVSSWLCQEPEPCHPGFDAESYTFTVPRRHLERGRVLGRVSFEDC
TGRQRTAYFSLDTRFKVGTDGVITVKRPLQFHNPQIHFLVYAWDSTYRKFSTKVTLNTVG
HHHRPPPHQASVSGIQAELLTFPNSSPGLRRQKRDWVIPPISCPENEKGPFPKNLVQIKS
NKDKEGKVFYSITGQGADTPPVGVFIIERETGWLKVTEPLDREHIATYTLFSHAVSSNGN
AVEDPMEIVITVTDQNDNKPEFTQEVFKGSVMEGALPGTSVMEVTATDADDDVNTYNAAI
AYTILSQDPELPDKNMFTINKNTGVISVVTTGLDRESFPTYTLVVQAADLQGDGLSTTAT
AVITVTDTNDNPPIFNPTTYKGQVPENEANVVITTLKVTDADAPNTPAWEAVYTILNDND
GQFVVTTNPANNDGILKTAKVCMLARCRNWHPRSCSCPCPLGLDFEAKQQYILHVAVTNV
VPFEVSLTTSTATVTVDVLDVNEAPIFVPPEKRVEVSEDFGVGQEITSYTAREPDTFMEQ
KITYRIWRDTANWLEINPDTGAISTRAELDRENFEHVKNSTYTALIIATDNGSPVATGTG
TLLLILSDVNDNAPIPEPRTIFFCERNPKPQVINIIDADLPPNTSPFTAELTHGASANWT
IQYNDPTQESIILKPKMALEVGDYKINLKLMDNQNKDQVTTLEVSVCDCEGAAGVCRKAQ
PVEAGLQIPAILGILGGILALLILILLLLLFLRRRAVVKEPLLPPEDDTRDNVYYYDEEG
GGEEDQDFDLSQLHRGLDARPEVTRNDVAPTLMSVPRYLPRPANPDEIGNFIDENLKAAD
TDPTAPPYDSLLVFDYEGSGSEAASLSSLNSSESDKDQDYDYLNEWGNRFKKLADMYGGG
EDD
Download sequence
Identical sequences ENSNLEP00000006507 ENSNLEP00000006507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]