SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000006511 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000006511
Domain Number 1 Region: 250-387
Classification Level Classification E-value
Superfamily Cadherin-like 1.31e-32
Family Cadherin 0.00000679
Further Details:      
 
Domain Number 2 Region: 27-173
Classification Level Classification E-value
Superfamily Cadherin-like 2.57e-24
Family Cadherin 0.0021
Further Details:      
 
Domain Number 3 Region: 475-602
Classification Level Classification E-value
Superfamily Cadherin-like 1.3e-23
Family Cadherin 0.00016
Further Details:      
 
Domain Number 4 Region: 369-480
Classification Level Classification E-value
Superfamily Cadherin-like 1.21e-20
Family Cadherin 0.0000497
Further Details:      
 
Domain Number 5 Region: 159-254
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000005
Family Cadherin 0.00000168
Further Details:      
 
Domain Number 6 Region: 589-691
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000659
Family Cadherin 0.0000605
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000006511   Gene: ENSNLEG00000005326   Transcript: ENSNLET00000006840
Sequence length 882
Comment pep:known_by_projection supercontig:Nleu1.0:GL397289.1:21448380:21554685:1 gene:ENSNLEG00000005326 transcript:ENSNLET00000006840 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPWSLSLSALLLLLQVSSWLCQEPEPCHPGFDAESYTFTVPRRHLERGRVLGRVSFEDC
TGRQRTAYFSLDTRFKVGTDGVITVKRPLQFHNPQIHFLVYAWDSTYRKFSTKVTLNTVG
HHHRPPPHQASVSGIQAELLTFPNSSPGLRRQKRDWVIPPISCPENEKGPFPKNLVQIKS
NKDKEGKVFYSITGQGADTPPVGVFIIERETGWLKVTEPLDREHIATYTLFSHAVSSNGN
AVEDPMEIVITVTDQNDNKPEFTQEVFKGSVMEGALPGTSVMEVTATDADDDVNTYNAAI
AYTILSQDPELPDKNMFTINKNTGVISVVTTGLDRESFPTYTLVVQAADLQGDGLSTTAT
AVITVTDTNDNPPIFNPTTYKGQVPENEANVVITTLKVTDADAPNTPAWEAVYTILNDND
GQFVVTTNPANNDGILKTAKGLDFEAKQQYILHVAVTNVVPFEVSLTTSTATVTVDVLDV
NEAPIFVPPEKRVEVSEDFGVGQEITSYTAREPDTFMEQKITYRIWRDTANWLEINPDTG
AISTRAELDRENFEHVKNSTYTALIIATDNGSPVATGTGTLLLILSDVNDNAPIPEPRTI
FFCERNPKPQVINIIDADLPPNTSPFTAELTHGASANWTIQYNDPTQESIILKPKMALEV
GDYKINLKLMDNQNKDQVTTLEVSVCDCEGAAGVCRKAQPVEAGLQIPAILGILGGILAL
LILILLLLLFLRRRAVVKEPLLPPEDDTRDNVYYYDEEGGGEEDQDFDLSQLHRGLDARP
EVTRNDVAPTLMSVPRYLPRPANPDEIGNFIDENLKAADTDPTAPPYDSLLVFDYEGSGS
EAASLSSLNSSESDKDQDYDYLNEWGNRFKKLADMYGGGEDD
Download sequence
Identical sequences ENSNLEP00000006511 XP_003262975.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]