SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000006592 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000006592
Domain Number 1 Region: 214-454
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 3.79e-17
Family Soluble quinoprotein glucose dehydrogenase 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000006592
Domain Number - Region: 638-670
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000176
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000006592   Gene: ENSNLEG00000005430   Transcript: ENSNLET00000006924
Sequence length 700
Comment pep:known_by_projection supercontig:Nleu1.0:GL397272.1:10577686:10674956:1 gene:ENSNLEG00000005430 transcript:ENSNLET00000006924 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKMLSFKLLLLAVALGFFEGDAKFGERNEGSGARRRRCLNGNPPKRLKRRDRRMMSQLE
LLSGGEMLCGGFYPRLSCCLRSDSPGLGRLENKIFSVTNNTECGKLLEEIKCALCSPHSQ
SLFHSPEREVLERDLVLPLLCKDYCKEFFYTCRGHIPGFLQTTADEFCFYYARKDGGLCF
PDFPRKQVRGPASNYLDQMEEYDKVEEISRKHKHNCFCIQEVVSGLRQPVGALHSGDGSH
RLFILEKEGYVKILTPEGEIFKEPYLDIHKLVQSGIKGGDERGLLSLAFHPNYKKNGKLY
VSYTTNQERWAIGPHDHILRVVEYTVSRKNPHQVDLRTARVFLEVAELHRKHLGGQLLFG
PDGFLYIILGDGMITLDDMEEMDGLSDFTGSVLRLDVDTDMCNVPYSIPRSNPHFNSTNQ
PPEVFAHGLHDPGRCAVDRHPTDININLTILCSDSNGKNRSSARILQIIKGKDYESEPSL
LEFKPFSNGPLVGGFVYRGCQSERLYGSYVFGDRNGNFLTLQQSPVTKQWQEKPLCLGTS
GSCRGYFSGHILGFGEDELGEVYILSSSKSMTQTHNGKLYKIVDPKRPLMPEECRATVQP
AQTLTSECSRLCRNGYCTPTGKCCCSPGWEGDFCRIAKCEPACRHGGVCVRPNKCLCKKG
YLGLQCEQVDRNIRRVTRAGILDQIIDMTSYLLDLTSYIV
Download sequence
Identical sequences G1R071
ENSNLEP00000006592 ENSNLEP00000006592 XP_003257810.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]